BLASTX nr result
ID: Magnolia22_contig00018731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00018731 (618 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT41439.1 hypothetical protein g.44030, partial [Anthurium amni... 61 2e-07 >JAT41439.1 hypothetical protein g.44030, partial [Anthurium amnicola] JAT67001.1 hypothetical protein g.44028, partial [Anthurium amnicola] Length = 1200 Score = 60.8 bits (146), Expect = 2e-07 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 1/91 (1%) Frame = -2 Query: 329 EKIFKANADEGSASLEPIGGNDFSKVPIRAVRLVHEGVERVDDGPVEEPVYDSSPSAAAK 150 E+I A+EGS L+ G+ SK +++LV+ +E V+D V EPVYDSSP+A K Sbjct: 683 EEILSTRANEGSIDLQQSSGSS-SKDSSSSIQLVNREIEVVNDCHVVEPVYDSSPTAVEK 741 Query: 149 SISTVSG-EEDLFYVDKGIDKSTSAASDKQI 60 S+S ++ EE+ + +G KSTS+ S + + Sbjct: 742 SLSNIASLEEEFLHGSQGSFKSTSSLSSETL 772