BLASTX nr result
ID: Magnolia22_contig00017219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00017219 (608 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010248778.1 PREDICTED: zinc finger CCCH domain-containing pro... 84 2e-15 XP_010248777.1 PREDICTED: zinc finger CCCH domain-containing pro... 84 2e-15 XP_002277300.1 PREDICTED: zinc finger CCCH domain-containing pro... 76 9e-13 KOM32723.1 hypothetical protein LR48_Vigan01g227900 [Vigna angul... 74 1e-12 XP_004501830.1 PREDICTED: zinc finger CCCH domain-containing pro... 76 1e-12 XP_014630952.1 PREDICTED: zinc finger CCCH domain-containing pro... 75 3e-12 XP_014510155.1 PREDICTED: zinc finger CCCH domain-containing pro... 75 3e-12 XP_007155512.1 hypothetical protein PHAVU_003G207900g [Phaseolus... 75 3e-12 KHN34381.1 Zinc finger CCCH domain-containing protein 43 [Glycin... 75 3e-12 XP_003525622.1 PREDICTED: zinc finger CCCH domain-containing pro... 75 3e-12 KHN14074.1 Zinc finger CCCH domain-containing protein 43 [Glycin... 75 3e-12 XP_003549835.1 PREDICTED: zinc finger CCCH domain-containing pro... 75 3e-12 XP_016187611.1 PREDICTED: zinc finger CCCH domain-containing pro... 73 4e-12 XP_017409532.1 PREDICTED: zinc finger CCCH domain-containing pro... 74 4e-12 XP_007209937.1 hypothetical protein PRUPE_ppa004690mg [Prunus pe... 74 6e-12 XP_016651178.1 PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH ... 74 6e-12 KYP65329.1 Zinc finger CCCH domain-containing protein 43 [Cajanu... 74 8e-12 XP_017634465.1 PREDICTED: zinc finger CCCH domain-containing pro... 70 8e-12 XP_018503675.1 PREDICTED: zinc finger CCCH domain-containing pro... 74 9e-12 XP_018503674.1 PREDICTED: zinc finger CCCH domain-containing pro... 74 9e-12 >XP_010248778.1 PREDICTED: zinc finger CCCH domain-containing protein 67 isoform X2 [Nelumbo nucifera] Length = 447 Score = 84.0 bits (206), Expect = 2e-15 Identities = 41/79 (51%), Positives = 47/79 (59%) Frame = -1 Query: 608 MGLPLRPDQTICTHYSRHGICKFGPACKFDHPINNGXXXXXXXXXXXXXXXXXSVDNPVM 429 MGLPLRPDQ+ICTHY+R+GICKFGPACKFDHPIN P Sbjct: 375 MGLPLRPDQSICTHYNRYGICKFGPACKFDHPIN--------CAPSTSSIVSTPSQPPSF 426 Query: 428 ALADRVPDCENGSDALIQQ 372 ++ + C NG DALIQQ Sbjct: 427 GVSSSLDGCGNGGDALIQQ 445 >XP_010248777.1 PREDICTED: zinc finger CCCH domain-containing protein 67 isoform X1 [Nelumbo nucifera] Length = 450 Score = 84.0 bits (206), Expect = 2e-15 Identities = 41/79 (51%), Positives = 47/79 (59%) Frame = -1 Query: 608 MGLPLRPDQTICTHYSRHGICKFGPACKFDHPINNGXXXXXXXXXXXXXXXXXSVDNPVM 429 MGLPLRPDQ+ICTHY+R+GICKFGPACKFDHPIN P Sbjct: 378 MGLPLRPDQSICTHYNRYGICKFGPACKFDHPIN--------CAPSTSSIVSTPSQPPSF 429 Query: 428 ALADRVPDCENGSDALIQQ 372 ++ + C NG DALIQQ Sbjct: 430 GVSSSLDGCGNGGDALIQQ 448 >XP_002277300.1 PREDICTED: zinc finger CCCH domain-containing protein 67 [Vitis vinifera] CBI14883.3 unnamed protein product, partial [Vitis vinifera] Length = 484 Score = 76.3 bits (186), Expect = 9e-13 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPINNG 501 GLPLRPDQ ICTHY+R+GICKFGPACKFDHP+N G Sbjct: 407 GLPLRPDQNICTHYNRYGICKFGPACKFDHPVNYG 441 >KOM32723.1 hypothetical protein LR48_Vigan01g227900 [Vigna angularis] Length = 240 Score = 74.3 bits (181), Expect = 1e-12 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHP+N Sbjct: 168 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPVN 200 >XP_004501830.1 PREDICTED: zinc finger CCCH domain-containing protein 67-like [Cicer arietinum] Length = 472 Score = 75.9 bits (185), Expect = 1e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ +CTHYSR+GICKFGPACKFDHPIN Sbjct: 402 GLPLRPDQNVCTHYSRYGICKFGPACKFDHPIN 434 >XP_014630952.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like isoform X2 [Glycine max] Length = 468 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 396 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 428 >XP_014510155.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like [Vigna radiata var. radiata] Length = 482 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 410 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 442 >XP_007155512.1 hypothetical protein PHAVU_003G207900g [Phaseolus vulgaris] ESW27506.1 hypothetical protein PHAVU_003G207900g [Phaseolus vulgaris] Length = 485 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 413 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 445 >KHN34381.1 Zinc finger CCCH domain-containing protein 43 [Glycine soja] Length = 490 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 418 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 450 >XP_003525622.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like isoform X1 [Glycine max] KRH57183.1 hypothetical protein GLYMA_05G044300 [Glycine max] Length = 490 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 418 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 450 >KHN14074.1 Zinc finger CCCH domain-containing protein 43 [Glycine soja] Length = 501 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 428 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 460 >XP_003549835.1 PREDICTED: zinc finger CCCH domain-containing protein 67 [Glycine max] KRH03901.1 hypothetical protein GLYMA_17G126800 [Glycine max] Length = 501 Score = 74.7 bits (182), Expect = 3e-12 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHPIN Sbjct: 428 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPIN 460 >XP_016187611.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like [Arachis ipaensis] Length = 244 Score = 72.8 bits (177), Expect = 4e-12 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPINN 504 GLPLRPDQ +C+HYSR+GICKFGPACKFDHP+ N Sbjct: 171 GLPLRPDQNVCSHYSRYGICKFGPACKFDHPVIN 204 >XP_017409532.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like [Vigna angularis] BAT75996.1 hypothetical protein VIGAN_01394600 [Vigna angularis var. angularis] Length = 482 Score = 74.3 bits (181), Expect = 4e-12 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACKFDHP+N Sbjct: 410 GLPLRPDQSVCSHYSRYGICKFGPACKFDHPVN 442 >XP_007209937.1 hypothetical protein PRUPE_ppa004690mg [Prunus persica] ONI08140.1 hypothetical protein PRUPE_5G159100 [Prunus persica] Length = 496 Score = 73.9 bits (180), Expect = 6e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ ICTHYSR+GICKFGP CKFDHP+N Sbjct: 422 GLPLRPDQNICTHYSRYGICKFGPVCKFDHPLN 454 >XP_016651178.1 PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 43-like [Prunus mume] Length = 500 Score = 73.9 bits (180), Expect = 6e-12 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ ICTHYSR+GICKFGP CKFDHP+N Sbjct: 426 GLPLRPDQNICTHYSRYGICKFGPVCKFDHPLN 458 >KYP65329.1 Zinc finger CCCH domain-containing protein 43 [Cajanus cajan] Length = 482 Score = 73.6 bits (179), Expect = 8e-12 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ++C+HYSR+GICKFGPACK+DHPIN Sbjct: 411 GLPLRPDQSVCSHYSRYGICKFGPACKYDHPIN 443 >XP_017634465.1 PREDICTED: zinc finger CCCH domain-containing protein 13-like isoform X3 [Gossypium arboreum] Length = 156 Score = 70.1 bits (170), Expect = 8e-12 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDH 516 GLPLRPDQTIC+HYSR+GICKFGPACKFDH Sbjct: 84 GLPLRPDQTICSHYSRYGICKFGPACKFDH 113 >XP_018503675.1 PREDICTED: zinc finger CCCH domain-containing protein 43-like isoform X8 [Pyrus x bretschneideri] Length = 601 Score = 73.6 bits (179), Expect = 9e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ ICTHYSR+GICKFGPACKFDHP++ Sbjct: 526 GLPLRPDQNICTHYSRYGICKFGPACKFDHPLH 558 >XP_018503674.1 PREDICTED: zinc finger CCCH domain-containing protein 67-like isoform X7 [Pyrus x bretschneideri] Length = 613 Score = 73.6 bits (179), Expect = 9e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 605 GLPLRPDQTICTHYSRHGICKFGPACKFDHPIN 507 GLPLRPDQ ICTHYSR+GICKFGPACKFDHP++ Sbjct: 538 GLPLRPDQNICTHYSRYGICKFGPACKFDHPLH 570