BLASTX nr result
ID: Magnolia22_contig00015309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015309 (641 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013314800.1 hypothetical protein PV05_06587 [Exophiala xenobi... 55 2e-06 >XP_013314800.1 hypothetical protein PV05_06587 [Exophiala xenobiotica] KIW54216.1 hypothetical protein PV05_06587 [Exophiala xenobiotica] Length = 115 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 444 NMEDIDPDNIIGGRTRGKIIDWNEAEQKAKEAG 346 +ME+IDPDNII GRTR K IDW EAEQK+K+AG Sbjct: 58 DMEEIDPDNIIQGRTRRKQIDWAEAEQKSKDAG 90