BLASTX nr result
ID: Magnolia22_contig00015171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015171 (567 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KQK00602.1 hypothetical protein BRADI_3g50605 [Brachypodium dist... 61 2e-09 >KQK00602.1 hypothetical protein BRADI_3g50605 [Brachypodium distachyon] Length = 61 Score = 60.8 bits (146), Expect = 2e-09 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = -3 Query: 391 MWILALGFSLIPVTLFLPPCRLLTRLVAKLQQLCEAVTGIRSAFPGAWSTLASLQSITFR 212 M IL LG ++PVTL PCR L LVAKLQ+L ++ RS+ P WS LA LQ+IT Sbjct: 1 MLILVLGIWILPVTLIFAPCRRLVLLVAKLQELEASIMRTRSSSPAMWSRLARLQTITIT 60 Query: 211 V 209 V Sbjct: 61 V 61