BLASTX nr result
ID: Magnolia22_contig00015031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015031 (983 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI19034.1 hypothetical protein PRUPE_3G255200 [Prunus persica] 59 4e-06 >ONI19034.1 hypothetical protein PRUPE_3G255200 [Prunus persica] Length = 536 Score = 59.3 bits (142), Expect = 4e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 977 ASLHQVFSLTFYEADRPVLDLSVGSLVCIFHRIFRSGVAI 858 A +HQVFSLTFY A+ +LDLS+G LVCIFHR+F G AI Sbjct: 483 AKVHQVFSLTFYVANMAILDLSIGPLVCIFHRVFNLGGAI 522