BLASTX nr result
ID: Magnolia22_contig00014980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00014980 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT58656.1 putative disease resistance RPP8-like protein 2 [Anth... 54 5e-06 >JAT58656.1 putative disease resistance RPP8-like protein 2 [Anthurium amnicola] Length = 906 Score = 53.5 bits (127), Expect = 5e-06 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 18/63 (28%) Frame = -1 Query: 321 PSLLHLRISDCNRLKKLP------------------DEFKARVREDGGEDWYKIRHIPSI 196 P L LRI+ C +L+ LP DEF +RVR++ GEDWYKI+HIPSI Sbjct: 839 PCLKSLRINSCKKLQMLPQGLQHLLDLQEFVLRNMPDEFNSRVRKEEGEDWYKIQHIPSI 898 Query: 195 DIH 187 ++ Sbjct: 899 SVN 901