BLASTX nr result
ID: Magnolia22_contig00014322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00014322 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010271193.1 PREDICTED: bZIP transcription factor 16-like isof... 63 9e-09 XP_010271189.1 PREDICTED: bZIP transcription factor 16-like isof... 63 1e-08 >XP_010271193.1 PREDICTED: bZIP transcription factor 16-like isoform X2 [Nelumbo nucifera] Length = 356 Score = 62.8 bits (151), Expect = 9e-09 Identities = 35/68 (51%), Positives = 36/68 (52%) Frame = -3 Query: 205 MGNEEAGTPAKTXXXXXXXXXXXXXXXXXXXADWASYQAYYNPAGTXXXXXPLGFFHSSV 26 MGN E TP KT DWAS+QAYYN AGT P GFFHS V Sbjct: 1 MGNAETDTPTKTPKSSSAQEQPPASSTATVFPDWASFQAYYNSAGTPPIPPP-GFFHSPV 59 Query: 25 ASSPQAHP 2 ASSPQAHP Sbjct: 60 ASSPQAHP 67 >XP_010271189.1 PREDICTED: bZIP transcription factor 16-like isoform X1 [Nelumbo nucifera] XP_010271190.1 PREDICTED: bZIP transcription factor 16-like isoform X1 [Nelumbo nucifera] XP_010271191.1 PREDICTED: bZIP transcription factor 16-like isoform X1 [Nelumbo nucifera] XP_010271192.1 PREDICTED: bZIP transcription factor 16-like isoform X1 [Nelumbo nucifera] Length = 406 Score = 62.8 bits (151), Expect = 1e-08 Identities = 35/68 (51%), Positives = 36/68 (52%) Frame = -3 Query: 205 MGNEEAGTPAKTXXXXXXXXXXXXXXXXXXXADWASYQAYYNPAGTXXXXXPLGFFHSSV 26 MGN E TP KT DWAS+QAYYN AGT P GFFHS V Sbjct: 1 MGNAETDTPTKTPKSSSAQEQPPASSTATVFPDWASFQAYYNSAGTPPIPPP-GFFHSPV 59 Query: 25 ASSPQAHP 2 ASSPQAHP Sbjct: 60 ASSPQAHP 67