BLASTX nr result
ID: Magnolia22_contig00012790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00012790 (658 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK60311.1 uncharacterized protein A4U43_C08F16810 [Asparagus of... 88 6e-19 OMO73241.1 hypothetical protein CCACVL1_17377 [Corchorus capsula... 85 6e-18 OMO85921.1 Membrane-anchored ubiquitin-fold protein, HCG-1 [Corc... 85 6e-18 XP_007032679.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 85 9e-18 XP_004304248.2 PREDICTED: membrane-anchored ubiquitin-fold prote... 85 1e-17 XP_011467907.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 85 1e-17 XP_010029328.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 84 2e-17 EOY03606.1 Membrane-anchored ubiquitin-fold protein 1 precursor ... 85 2e-17 XP_007217187.1 hypothetical protein PRUPE_ppa013551mg [Prunus pe... 84 2e-17 XP_010089604.1 hypothetical protein L484_020996 [Morus notabilis... 83 4e-17 XP_004141460.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 83 7e-17 EEF36272.1 conserved hypothetical protein [Ricinus communis] 82 9e-17 XP_002526078.2 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 XP_011035848.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 XP_008459370.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 XP_002305375.1 hypothetical protein POPTR_0004s12350g [Populus t... 82 1e-16 XP_008459365.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 KCW56232.1 hypothetical protein EUGRSUZ_I01980 [Eucalyptus grandis] 84 1e-16 XP_009360557.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 XP_008341639.1 PREDICTED: membrane-anchored ubiquitin-fold prote... 82 1e-16 >ONK60311.1 uncharacterized protein A4U43_C08F16810 [Asparagus officinalis] Length = 119 Score = 88.2 bits (217), Expect = 6e-19 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 MSGVQEQLEIKFRLHDGSDIGPK +P+ATSVAT+KESILA+WPKEK Sbjct: 1 MSGVQEQLEIKFRLHDGSDIGPKMYPSATSVATLKESILAEWPKEK 46 >OMO73241.1 hypothetical protein CCACVL1_17377 [Corchorus capsularis] Length = 100 Score = 85.1 bits (209), Expect = 6e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSVAT+KES+LAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKAFPAATSVATLKESVLAQWPKEK 46 >OMO85921.1 Membrane-anchored ubiquitin-fold protein, HCG-1 [Corchorus olitorius] Length = 104 Score = 85.1 bits (209), Expect = 6e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSVAT+KES+LAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKAFPAATSVATLKESVLAQWPKEK 46 >XP_007032679.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Theobroma cacao] XP_017975907.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Theobroma cacao] EOY03605.1 Membrane-anchored ubiquitin-fold protein 1 precursor isoform 1 [Theobroma cacao] Length = 117 Score = 85.1 bits (209), Expect = 9e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSVAT+KES+LAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKTFPAATSVATLKESVLAQWPKEK 46 >XP_004304248.2 PREDICTED: membrane-anchored ubiquitin-fold protein 1 isoform X2 [Fragaria vesca subsp. vesca] XP_011467909.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1 isoform X2 [Fragaria vesca subsp. vesca] Length = 114 Score = 84.7 bits (208), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSV+T+KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLSDGSDIGPKSFPAATSVSTLKESILAQWPKEK 46 >XP_011467907.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 isoform X1 [Fragaria vesca subsp. vesca] XP_011467908.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 isoform X1 [Fragaria vesca subsp. vesca] Length = 115 Score = 84.7 bits (208), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSV+T+KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLSDGSDIGPKSFPAATSVSTLKESILAQWPKEK 46 >XP_010029328.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Eucalyptus grandis] Length = 115 Score = 84.3 bits (207), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 MS VQ+QLEIKFRL DGSDIGPK FPAATSVAT+KESILAQWPKEK Sbjct: 1 MSSVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESILAQWPKEK 46 >EOY03606.1 Membrane-anchored ubiquitin-fold protein 1 precursor isoform 2 [Theobroma cacao] Length = 144 Score = 85.1 bits (209), Expect = 2e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSVAT+KES+LAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKTFPAATSVATLKESVLAQWPKEK 46 >XP_007217187.1 hypothetical protein PRUPE_ppa013551mg [Prunus persica] XP_008230848.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] XP_008230849.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] XP_008230850.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Prunus mume] ONI19089.1 hypothetical protein PRUPE_3G258300 [Prunus persica] ONI19090.1 hypothetical protein PRUPE_3G258300 [Prunus persica] ONI19091.1 hypothetical protein PRUPE_3G258300 [Prunus persica] Length = 117 Score = 84.0 bits (206), Expect = 2e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSV T+KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKSFPAATSVVTLKESILAQWPKEK 46 >XP_010089604.1 hypothetical protein L484_020996 [Morus notabilis] EXB38075.1 hypothetical protein L484_020996 [Morus notabilis] Length = 114 Score = 83.2 bits (204), Expect = 4e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAAT+V+T+KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKSFPAATNVSTLKESILAQWPKEK 46 >XP_004141460.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Cucumis sativus] XP_004141461.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Cucumis sativus] XP_011656006.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Cucumis sativus] KGN52499.1 hypothetical protein Csa_5G638380 [Cucumis sativus] Length = 117 Score = 82.8 bits (203), Expect = 7e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GV +QLEIKFRL+DGSDIGPK FPAATSVAT+KESILAQWP+EK Sbjct: 1 MAGVGDQLEIKFRLNDGSDIGPKTFPAATSVATLKESILAQWPREK 46 >EEF36272.1 conserved hypothetical protein [Ricinus communis] Length = 113 Score = 82.4 bits (202), Expect = 9e-17 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+ VQ QLEIKFRL DGSDIGPK FPAATSVAT+KESILAQWPKEK Sbjct: 1 MAAVQNQLEIKFRLTDGSDIGPKTFPAATSVATLKESILAQWPKEK 46 >XP_002526078.2 PREDICTED: membrane-anchored ubiquitin-fold protein 2 [Ricinus communis] Length = 117 Score = 82.4 bits (202), Expect = 1e-16 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+ VQ QLEIKFRL DGSDIGPK FPAATSVAT+KESILAQWPKEK Sbjct: 1 MAAVQNQLEIKFRLTDGSDIGPKTFPAATSVATLKESILAQWPKEK 46 >XP_011035848.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Populus euphratica] Length = 117 Score = 82.4 bits (202), Expect = 1e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGP FPAATSVAT+KE+ILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPNTFPAATSVATLKENILAQWPKEK 46 >XP_008459370.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like isoform X2 [Cucumis melo] XP_008459372.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like isoform X2 [Cucumis melo] Length = 117 Score = 82.4 bits (202), Expect = 1e-16 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GV +QLEIKFRL+DGSDIGPK FPAATS+AT+KESILAQWP+EK Sbjct: 1 MAGVGDQLEIKFRLNDGSDIGPKTFPAATSIATLKESILAQWPREK 46 >XP_002305375.1 hypothetical protein POPTR_0004s12350g [Populus trichocarpa] XP_011013390.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Populus euphratica] XP_011013391.1 PREDICTED: membrane-anchored ubiquitin-fold protein 2-like [Populus euphratica] ABK96631.1 unknown [Populus trichocarpa x Populus deltoides] EEE85886.1 hypothetical protein POPTR_0004s12350g [Populus trichocarpa] Length = 117 Score = 82.4 bits (202), Expect = 1e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSVAT+KE+ILA WPKEK Sbjct: 1 MAGVQDQLEIKFRLADGSDIGPKTFPAATSVATLKENILAHWPKEK 46 >XP_008459365.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform X1 [Cucumis melo] XP_008459366.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform X1 [Cucumis melo] XP_008459367.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform X1 [Cucumis melo] XP_008459368.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like isoform X1 [Cucumis melo] Length = 125 Score = 82.4 bits (202), Expect = 1e-16 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GV +QLEIKFRL+DGSDIGPK FPAATS+AT+KESILAQWP+EK Sbjct: 1 MAGVGDQLEIKFRLNDGSDIGPKTFPAATSIATLKESILAQWPREK 46 >KCW56232.1 hypothetical protein EUGRSUZ_I01980 [Eucalyptus grandis] Length = 202 Score = 84.3 bits (207), Expect = 1e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 MS VQ+QLEIKFRL DGSDIGPK FPAATSVAT+KESILAQWPKEK Sbjct: 1 MSSVQDQLEIKFRLTDGSDIGPKSFPAATSVATLKESILAQWPKEK 46 >XP_009360557.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] XP_018503866.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1-like [Pyrus x bretschneideri] Length = 117 Score = 82.0 bits (201), Expect = 1e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSV +KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKSFPAATSVVNLKESILAQWPKEK 46 >XP_008341639.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Malus domestica] XP_008341640.1 PREDICTED: membrane-anchored ubiquitin-fold protein 1 [Malus domestica] Length = 117 Score = 82.0 bits (201), Expect = 1e-16 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -3 Query: 140 MSGVQEQLEIKFRLHDGSDIGPKRFPAATSVATVKESILAQWPKEK 3 M+GVQ+QLEIKFRL DGSDIGPK FPAATSV +KESILAQWPKEK Sbjct: 1 MAGVQDQLEIKFRLTDGSDIGPKSFPAATSVVNLKESILAQWPKEK 46