BLASTX nr result
ID: Magnolia22_contig00012359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00012359 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016764424.1 ribosomal protein L22e, partial [Sphaerulina musi... 64 6e-11 KXL51273.1 hypothetical protein FE78DRAFT_26635 [Acidomyces rich... 63 1e-10 EME49534.1 hypothetical protein DOTSEDRAFT_121936, partial [Doth... 63 2e-10 XP_007674160.1 hypothetical protein BAUCODRAFT_120485 [Baudoinia... 63 2e-10 KJX93870.1 60s ribosomal protein l22 [Zymoseptoria brevis] 63 2e-10 KXT01504.1 hypothetical protein AC578_4555 [Mycosphaerella eumusae] 63 2e-10 CRK12358.1 hypothetical protein BN1723_017291, partial [Verticil... 57 7e-09 XP_007789866.1 putative 60s ribosomal protein l22 protein [Eutyp... 59 8e-09 XP_014172557.1 60S ribosomal protein l22 [Grosmannia clavigera k... 59 8e-09 CCF37206.1 ribosomal L22e family protein [Colletotrichum higgins... 59 8e-09 XP_003719728.1 60S ribosomal protein L22 [Magnaporthe oryzae 70-... 59 8e-09 OIW28537.1 ribosomal protein L22e [Coniochaeta ligniaria NRRL 30... 59 9e-09 OLN93081.1 60S ribosomal protein L22 [Colletotrichum chlorophyti] 59 9e-09 KXH62479.1 ribosomal L22e family protein [Colletotrichum salicis] 59 9e-09 KLU83822.1 60S ribosomal protein L22 [Magnaporthiopsis poae ATCC... 59 9e-09 XP_007596290.1 ribosomal L22e family protein [Colletotrichum fio... 59 9e-09 ENH81849.1 60s ribosomal protein l22 [Colletotrichum orbiculare ... 59 9e-09 XP_007285434.1 60s ribosomal protein l22 [Colletotrichum gloeosp... 59 9e-09 XP_009226060.1 60S ribosomal protein L22 [Gaeumannomyces tritici... 59 9e-09 XP_008093055.1 ribosomal L22e family protein [Colletotrichum gra... 59 9e-09 >XP_016764424.1 ribosomal protein L22e, partial [Sphaerulina musiva SO2202] EMF16303.1 ribosomal protein L22e, partial [Sphaerulina musiva SO2202] Length = 118 Score = 63.9 bits (154), Expect = 6e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVSTAKGEYSLKFFNVV Sbjct: 79 KKFLKKQQLRDWLRVVSTAKGEYSLKFFNVV 109 >KXL51273.1 hypothetical protein FE78DRAFT_26635 [Acidomyces richmondensis] KYG48619.1 hypothetical protein M433DRAFT_131950 [Acidomyces richmondensis BFW] Length = 112 Score = 62.8 bits (151), Expect = 1e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KGEYSLKFFNVV Sbjct: 73 KKFLKKQQLRDWLRVVSTSKGEYSLKFFNVV 103 >EME49534.1 hypothetical protein DOTSEDRAFT_121936, partial [Dothistroma septosporum NZE10] Length = 118 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KGEYSLKFFNVV Sbjct: 79 KKFLKKQQLRDWLRVVSTSKGEYSLKFFNVV 109 >XP_007674160.1 hypothetical protein BAUCODRAFT_120485 [Baudoinia panamericana UAMH 10762] EMC99191.1 hypothetical protein BAUCODRAFT_120485 [Baudoinia panamericana UAMH 10762] Length = 124 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVV+TAKGEYSLKFFNVV Sbjct: 85 KKFLKKQQLRDWLRVVATAKGEYSLKFFNVV 115 >KJX93870.1 60s ribosomal protein l22 [Zymoseptoria brevis] Length = 130 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KGEYSLKFFNVV Sbjct: 91 KKFLKKQQLRDWLRVVSTSKGEYSLKFFNVV 121 >KXT01504.1 hypothetical protein AC578_4555 [Mycosphaerella eumusae] Length = 138 Score = 62.8 bits (151), Expect = 2e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KGEYSLKFFNVV Sbjct: 99 KKFLKKQQLRDWLRVVSTSKGEYSLKFFNVV 129 >CRK12358.1 hypothetical protein BN1723_017291, partial [Verticillium longisporum] Length = 41 Score = 56.6 bits (135), Expect = 7e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVV+T+KG Y+LKF+NVV Sbjct: 2 KKFLKKQQLRDWLRVVATSKGVYTLKFYNVV 32 >XP_007789866.1 putative 60s ribosomal protein l22 protein [Eutypa lata UCREL1] EMR71028.1 putative 60s ribosomal protein l22 protein [Eutypa lata UCREL1] Length = 124 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 85 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 115 >XP_014172557.1 60S ribosomal protein l22 [Grosmannia clavigera kw1407] EFX03075.1 60S ribosomal protein l22 [Grosmannia clavigera kw1407] Length = 124 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 85 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 115 >CCF37206.1 ribosomal L22e family protein [Colletotrichum higginsianum] Length = 125 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 86 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 116 >XP_003719728.1 60S ribosomal protein L22 [Magnaporthe oryzae 70-15] ADD84575.1 60S ribosomal protein L22 [Magnaporthe oryzae] EHA47361.1 60S ribosomal protein L22 [Magnaporthe oryzae 70-15] ELQ41766.1 60S ribosomal protein L22 [Magnaporthe oryzae Y34] ELQ59510.1 60S ribosomal protein L22 [Magnaporthe oryzae P131] Length = 125 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 86 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 116 >OIW28537.1 ribosomal protein L22e [Coniochaeta ligniaria NRRL 30616] Length = 127 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 88 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 118 >OLN93081.1 60S ribosomal protein L22 [Colletotrichum chlorophyti] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >KXH62479.1 ribosomal L22e family protein [Colletotrichum salicis] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >KLU83822.1 60S ribosomal protein L22 [Magnaporthiopsis poae ATCC 64411] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >XP_007596290.1 ribosomal L22e family protein [Colletotrichum fioriniae PJ7] EXF80067.1 ribosomal L22e family protein [Colletotrichum fioriniae PJ7] KXH30701.1 ribosomal L22e family protein [Colletotrichum nymphaeae SA-01] KXH41715.1 ribosomal L22e family protein [Colletotrichum simmondsii] OHE92875.1 ribosomal L22e family protein [Colletotrichum orchidophilum] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >ENH81849.1 60s ribosomal protein l22 [Colletotrichum orbiculare MAFF 240422] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >XP_007285434.1 60s ribosomal protein l22 [Colletotrichum gloeosporioides Nara gc5] ELA25513.1 60s ribosomal protein l22 [Colletotrichum gloeosporioides Nara gc5] EQB49914.1 ribosomal L22e family protein [Colletotrichum gloeosporioides Cg-14] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >XP_009226060.1 60S ribosomal protein L22 [Gaeumannomyces tritici R3-111a-1] EJT73086.1 60S ribosomal protein L22 [Gaeumannomyces tritici R3-111a-1] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119 >XP_008093055.1 ribosomal L22e family protein [Colletotrichum graminicola M1.001] EFQ29035.1 ribosomal L22e family protein [Colletotrichum graminicola M1.001] KDN63231.1 putative ribosomal L22e family protein [Colletotrichum sublineola] Length = 128 Score = 58.5 bits (140), Expect = 9e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 KKFLKKQKLRDWLRVVSTAKGEYSLKFFNVV 94 KKFLKKQ+LRDWLRVVST+KG Y LKFFNVV Sbjct: 89 KKFLKKQQLRDWLRVVSTSKGVYELKFFNVV 119