BLASTX nr result
ID: Magnolia22_contig00011930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00011930 (677 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009385962.1 PREDICTED: uncharacterized protein LOC103973186 [... 56 7e-07 >XP_009385962.1 PREDICTED: uncharacterized protein LOC103973186 [Musa acuminata subsp. malaccensis] Length = 95 Score = 55.8 bits (133), Expect = 7e-07 Identities = 36/95 (37%), Positives = 47/95 (49%), Gaps = 5/95 (5%) Frame = -1 Query: 416 MGME-GIIEFPTIAPIQIADKDP----TDASEGECHTPKSNVIKPLLVCXXXXXXXXXXX 252 MG E + E PT+API+ D T + EC TPKS LVC Sbjct: 1 MGFEFDVYELPTLAPIRTTGNDDPLKSTSTEDVECITPKSEEPVRALVCPPAPWKPRPAK 60 Query: 251 XXXXXXPQGYFVVPANLDSIFVALHVPPTKKIKSG 147 P+GY+ VP++L S+FV L PP+KKI+ G Sbjct: 61 RRLAPPPRGYYPVPSDLLSVFVPLPCPPSKKIRVG 95