BLASTX nr result
ID: Magnolia22_contig00011781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00011781 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU42840.1 hypothetical protein MIMGU_mgv1a017484mg [Erythranthe... 52 2e-06 EYU42839.1 hypothetical protein MIMGU_mgv1a017484mg [Erythranthe... 52 2e-06 >EYU42840.1 hypothetical protein MIMGU_mgv1a017484mg [Erythranthe guttata] Length = 71 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +1 Query: 283 KDGFSDPHQAPPVENKDKGDGFLKGCCAALC 375 KDG QAPPV + KGDGFLKGCCAALC Sbjct: 32 KDGHDQQGQAPPVTTQSKGDGFLKGCCAALC 62 >EYU42839.1 hypothetical protein MIMGU_mgv1a017484mg [Erythranthe guttata] Length = 72 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +1 Query: 283 KDGFSDPHQAPPVENKDKGDGFLKGCCAALC 375 KDG QAPPV + KGDGFLKGCCAALC Sbjct: 33 KDGHDQQGQAPPVTTQSKGDGFLKGCCAALC 63