BLASTX nr result
ID: Magnolia22_contig00011109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00011109 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009785862.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 87 2e-17 XP_018626677.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 87 2e-17 XP_009601988.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 87 3e-17 XP_019228729.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 87 3e-17 XP_009785861.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 87 3e-17 XP_011076789.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH ... 86 1e-16 XP_012858465.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 85 1e-16 XP_006355692.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 2e-16 XP_012858464.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 85 2e-16 XP_006355691.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 84 3e-16 XP_010256807.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 83 5e-16 XP_010256806.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 83 5e-16 XP_010256804.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 83 7e-16 XP_016573524.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 1e-15 XP_010321433.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 1e-15 XP_016573521.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 2e-15 XP_015074511.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 2e-15 XP_004239913.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 82 2e-15 XP_018632289.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 81 2e-15 XP_019231881.1 PREDICTED: BTB/POZ and MATH domain-containing pro... 81 2e-15 >XP_009785862.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana sylvestris] XP_009785863.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana sylvestris] XP_009785864.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana sylvestris] XP_016497646.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana tabacum] XP_016497647.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana tabacum] XP_016497648.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana tabacum] XP_019228730.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana attenuata] XP_019228731.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana attenuata] XP_019228732.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana attenuata] Length = 337 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 142 NSPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NS NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NSHDNDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 50 >XP_018626677.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana tomentosiformis] XP_018626678.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana tomentosiformis] XP_018626679.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana tomentosiformis] Length = 337 Score = 87.0 bits (214), Expect = 2e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 142 NSPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NS NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NSHDNDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 50 >XP_009601988.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X2 [Nicotiana tomentosiformis] XP_018626676.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Nicotiana tomentosiformis] Length = 403 Score = 87.0 bits (214), Expect = 3e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 142 NSPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NS NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NSHDNDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 50 >XP_019228729.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Nicotiana attenuata] OIT30547.1 btbpoz and math domain-containing protein 3 [Nicotiana attenuata] Length = 404 Score = 87.0 bits (214), Expect = 3e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 142 NSPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NS NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NSHDNDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 50 >XP_009785861.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Nicotiana sylvestris] XP_016497645.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X1 [Nicotiana tabacum] Length = 404 Score = 87.0 bits (214), Expect = 3e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 142 NSPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NS NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NSHDNDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 50 >XP_011076789.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ and MATH domain-containing protein 3 [Sesamum indicum] Length = 399 Score = 85.5 bits (210), Expect = 1e-16 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 2/50 (4%) Frame = -1 Query: 145 CNSPPN--DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 C+ P N DSSS+S+NETVNGSHH+TI+GYSLAKGMGPGKYISSDTF +G Sbjct: 5 CSEPNNALDSSSRSINETVNGSHHFTIRGYSLAKGMGPGKYISSDTFSIG 54 >XP_012858465.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Erythranthe guttata] EYU19945.1 hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata] Length = 340 Score = 84.7 bits (208), Expect = 1e-16 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 2/50 (4%) Frame = -1 Query: 145 CNSPPN--DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 C+ P N DSSS+SVNETVNGSHH+TI+GYSLAKGMGPGKYI+SDTF +G Sbjct: 5 CSEPNNGLDSSSRSVNETVNGSHHFTIRGYSLAKGMGPGKYIASDTFSIG 54 >XP_006355692.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum tuberosum] XP_015167959.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum tuberosum] Length = 340 Score = 84.3 bits (207), Expect = 2e-16 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 130 NDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 11 NDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 53 >XP_012858464.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Erythranthe guttata] EYU19944.1 hypothetical protein MIMGU_mgv1a007421mg [Erythranthe guttata] Length = 408 Score = 84.7 bits (208), Expect = 2e-16 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 2/50 (4%) Frame = -1 Query: 145 CNSPPN--DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 C+ P N DSSS+SVNETVNGSHH+TI+GYSLAKGMGPGKYI+SDTF +G Sbjct: 5 CSEPNNGLDSSSRSVNETVNGSHHFTIRGYSLAKGMGPGKYIASDTFSIG 54 >XP_006355691.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Solanum tuberosum] Length = 408 Score = 84.3 bits (207), Expect = 3e-16 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 130 NDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 NDSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 11 NDSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 53 >XP_010256807.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X3 [Nelumbo nucifera] Length = 350 Score = 83.2 bits (204), Expect = 5e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 136 PPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 P DSSSKS+NETVNGSHHYTIKGYSLAKGMG GKYISSD F VG Sbjct: 20 PLQDSSSKSINETVNGSHHYTIKGYSLAKGMGAGKYISSDVFSVG 64 >XP_010256806.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Nelumbo nucifera] Length = 354 Score = 83.2 bits (204), Expect = 5e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 136 PPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 P DSSSKS+NETVNGSHHYTIKGYSLAKGMG GKYISSD F VG Sbjct: 20 PLQDSSSKSINETVNGSHHYTIKGYSLAKGMGAGKYISSDVFSVG 64 >XP_010256804.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Nelumbo nucifera] XP_010256805.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Nelumbo nucifera] XP_019053308.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Nelumbo nucifera] Length = 419 Score = 83.2 bits (204), Expect = 7e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -1 Query: 136 PPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 P DSSSKS+NETVNGSHHYTIKGYSLAKGMG GKYISSD F VG Sbjct: 20 PLQDSSSKSINETVNGSHHYTIKGYSLAKGMGAGKYISSDVFSVG 64 >XP_016573524.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X4 [Capsicum annuum] XP_016573525.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X4 [Capsicum annuum] Length = 336 Score = 82.0 bits (201), Expect = 1e-15 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 139 SPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 +P + SSSKSVNET+NGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NPSDSSSSKSVNETINGSHHFTIRGYSLAKGMGPGKYISSDIFNVG 49 >XP_010321433.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum lycopersicum] XP_010321434.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum lycopersicum] XP_015074512.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum pennellii] XP_015074513.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X2 [Solanum pennellii] Length = 340 Score = 82.0 bits (201), Expect = 1e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 DSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 12 DSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 53 >XP_016573521.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Capsicum annuum] Length = 404 Score = 82.0 bits (201), Expect = 2e-15 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 139 SPPNDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 +P + SSSKSVNET+NGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 4 NPSDSSSSKSVNETINGSHHFTIRGYSLAKGMGPGKYISSDIFNVG 49 >XP_015074511.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Solanum pennellii] Length = 408 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 DSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 12 DSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 53 >XP_004239913.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3 isoform X1 [Solanum lycopersicum] Length = 408 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -1 Query: 127 DSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 DSSSKSVNETVNGSHH+TI+GYSLAKGMGPGKYISSD F VG Sbjct: 12 DSSSKSVNETVNGSHHFTIRGYSLAKGMGPGKYISSDIFTVG 53 >XP_018632289.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana tomentosiformis] Length = 342 Score = 81.3 bits (199), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 NDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 +DS SKS+NETVNGSHH+TI+GYSLAKGMGPGKYI+SDTF VG Sbjct: 14 SDSCSKSINETVNGSHHFTIRGYSLAKGMGPGKYITSDTFTVG 56 >XP_019231881.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana attenuata] XP_019231883.1 PREDICTED: BTB/POZ and MATH domain-containing protein 3-like isoform X3 [Nicotiana attenuata] Length = 343 Score = 81.3 bits (199), Expect = 2e-15 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -1 Query: 130 NDSSSKSVNETVNGSHHYTIKGYSLAKGMGPGKYISSDTFMVG 2 +DS SKS+NETVNGSHH+TI+GYSLAKGMGPGKYI+SDTF VG Sbjct: 14 SDSCSKSINETVNGSHHFTIRGYSLAKGMGPGKYITSDTFTVG 56