BLASTX nr result
ID: Magnolia22_contig00010961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00010961 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018032450.1 hypothetical protein CC84DRAFT_1220449 [Paraphaeo... 54 7e-07 XP_007704747.1 hypothetical protein COCSADRAFT_203494 [Bipolaris... 52 3e-06 XP_014077874.1 hypothetical protein COCC4DRAFT_141145 [Bipolaris... 51 6e-06 XP_018380773.1 hypothetical protein CC77DRAFT_1025097 [Alternari... 51 6e-06 XP_007685650.1 hypothetical protein COCMIDRAFT_3275 [Bipolaris o... 51 8e-06 OAL54060.1 hypothetical protein IQ07DRAFT_584636 [Pyrenochaeta s... 50 1e-05 XP_014555469.1 hypothetical protein COCVIDRAFT_38825 [Bipolaris ... 50 1e-05 >XP_018032450.1 hypothetical protein CC84DRAFT_1220449 [Paraphaeosphaeria sporulosa] OAG02085.1 hypothetical protein CC84DRAFT_1220449 [Paraphaeosphaeria sporulosa] Length = 70 Score = 53.5 bits (127), Expect = 7e-07 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPECGA ADLT D AHC SCN IFEP Sbjct: 1 MVKCPECGAGADLTKDGLYAHCASCNTIFEP 31 >XP_007704747.1 hypothetical protein COCSADRAFT_203494 [Bipolaris sorokiniana ND90Pr] EMD59765.1 hypothetical protein COCSADRAFT_203494 [Bipolaris sorokiniana ND90Pr] Length = 68 Score = 52.0 bits (123), Expect = 3e-06 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D + AHC SCN IFEP Sbjct: 1 MVKCPECDANADLTKDGAWAHCASCNTIFEP 31 >XP_014077874.1 hypothetical protein COCC4DRAFT_141145 [Bipolaris maydis ATCC 48331] EMD87042.1 hypothetical protein COCHEDRAFT_1114318 [Bipolaris maydis C5] ENI03965.1 hypothetical protein COCC4DRAFT_141145 [Bipolaris maydis ATCC 48331] Length = 62 Score = 50.8 bits (120), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D + AHC SCN IF+P Sbjct: 1 MVKCPECDANADLTKDGAWAHCASCNTIFQP 31 >XP_018380773.1 hypothetical protein CC77DRAFT_1025097 [Alternaria alternata] OAG15352.1 hypothetical protein CC77DRAFT_1025097 [Alternaria alternata] Length = 64 Score = 50.8 bits (120), Expect = 6e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D + AHC SCN +FEP Sbjct: 1 MVQCPECDAGADLTKDGAWAHCASCNTVFEP 31 >XP_007685650.1 hypothetical protein COCMIDRAFT_3275 [Bipolaris oryzae ATCC 44560] EUC47795.1 hypothetical protein COCMIDRAFT_3275 [Bipolaris oryzae ATCC 44560] Length = 71 Score = 50.8 bits (120), Expect = 8e-06 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D + AHC SCN IF+P Sbjct: 1 MVKCPECDANADLTKDGAWAHCASCNTIFQP 31 >OAL54060.1 hypothetical protein IQ07DRAFT_584636 [Pyrenochaeta sp. DS3sAY3a] Length = 66 Score = 50.4 bits (119), Expect = 1e-05 Identities = 22/31 (70%), Positives = 22/31 (70%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D AHC SCN IFEP Sbjct: 1 MVKCPECEANADLTKDGLWAHCASCNTIFEP 31 >XP_014555469.1 hypothetical protein COCVIDRAFT_38825 [Bipolaris victoriae FI3] EUN25892.1 hypothetical protein COCVIDRAFT_38825 [Bipolaris victoriae FI3] Length = 67 Score = 50.4 bits (119), Expect = 1e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = -3 Query: 353 MVNCPECGATADLTPDKSNAHCGSCNNIFEP 261 MV CPEC A ADLT D + AHC SCN IF+P Sbjct: 1 MVKCPECEANADLTKDGAWAHCASCNTIFQP 31