BLASTX nr result
ID: Magnolia22_contig00010694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00010694 (738 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008720768.1 hypothetical protein HMPREF1541_08226 [Cyphelloph... 56 4e-07 >XP_008720768.1 hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] ETN37236.1 hypothetical protein HMPREF1541_08226 [Cyphellophora europaea CBS 101466] Length = 59 Score = 55.8 bits (133), Expect = 4e-07 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = -1 Query: 381 LEDLRAALRKAFPELSPEDFQTAAGDREKLSKIVAEKKSISEDDAAKEVQAVW 223 +E RAALR F +++PE+F+ AG+R+ L K+V EK +SE++A KEV A++ Sbjct: 4 VEKTRAALRAKFDKITPEEFKNTAGNRDALYKLVVEKHGLSEEEAKKEVDAIF 56