BLASTX nr result
ID: Magnolia22_contig00010683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00010683 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN13096.1 hypothetical protein AMTR_s00040p00164100 [Amborella ... 51 8e-06 >ERN13096.1 hypothetical protein AMTR_s00040p00164100 [Amborella trichopoda] Length = 68 Score = 51.2 bits (121), Expect = 8e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 27 MSKSQSATRQALETPPPRVITVERRPAMEKRRLETINEECDGHGFK 164 M+K ATRQ +ET PPR+I V+RRP+ + RLETI EE DG+ K Sbjct: 1 MAKVLGATRQTMETAPPRIIKVDRRPSFD-LRLETIQEETDGNSRK 45