BLASTX nr result
ID: Magnolia22_contig00010519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00010519 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007733417.1 hypothetical protein A1O3_05100 [Capronia epimyce... 59 5e-07 XP_013313601.1 hypothetical protein PV05_08622 [Exophiala xenobi... 57 2e-06 KIV79957.1 hypothetical protein PV11_07496 [Exophiala sideris] 57 3e-06 OAL38251.1 hypothetical protein AYO20_02310 [Fonsecaea nubica] 55 9e-06 XP_013289098.1 hypothetical protein Z517_00680 [Fonsecaea pedros... 55 9e-06 XP_016260276.1 hypothetical protein PV06_08613 [Exophiala oligos... 55 9e-06 >XP_007733417.1 hypothetical protein A1O3_05100 [Capronia epimyces CBS 606.96] EXJ84432.1 hypothetical protein A1O3_05100 [Capronia epimyces CBS 606.96] Length = 264 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -3 Query: 138 NPYGGKTFEMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 NP GK DCG N +EARAKGC YDVMMQ+W P C D L E Sbjct: 103 NPLAGKIL---DCGHNPEEARAKGCVYDVMMQDWVPEPCYDSVLTE 145 >XP_013313601.1 hypothetical protein PV05_08622 [Exophiala xenobiotica] KIW53017.1 hypothetical protein PV05_08622 [Exophiala xenobiotica] Length = 257 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 114 EMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 E+ DCG N +EARAKGC +DVMMQ+W P +C D L+E Sbjct: 101 EIQDCGGNPEEARAKGCVFDVMMQDWMPADCYDEGLSE 138 >KIV79957.1 hypothetical protein PV11_07496 [Exophiala sideris] Length = 260 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 114 EMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 E+ CG NA+EARAKGC +DVMMQ WTP +C D L++ Sbjct: 104 EIQSCGYNAEEARAKGCVFDVMMQLWTPADCYDQVLSD 141 >OAL38251.1 hypothetical protein AYO20_02310 [Fonsecaea nubica] Length = 263 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = -3 Query: 120 TFEMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 T ++ DCG N +EARAKGC YDVMMQ+W P C D L E Sbjct: 105 TGQILDCGYNPEEARAKGCVYDVMMQDWVPEPCYDPILTE 144 >XP_013289098.1 hypothetical protein Z517_00680 [Fonsecaea pedrosoi CBS 271.37] KIW85290.1 hypothetical protein Z517_00680 [Fonsecaea pedrosoi CBS 271.37] OAG35823.1 hypothetical protein AYO21_09980 [Fonsecaea monophora] Length = 263 Score = 55.5 bits (132), Expect = 9e-06 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = -3 Query: 120 TFEMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 T ++ DCG N +EARAKGC YDVMMQ+W P C D L E Sbjct: 105 TGQILDCGYNPEEARAKGCVYDVMMQDWVPEPCYDPILTE 144 >XP_016260276.1 hypothetical protein PV06_08613 [Exophiala oligosperma] KIW40060.1 hypothetical protein PV06_08613 [Exophiala oligosperma] Length = 264 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/46 (56%), Positives = 28/46 (60%) Frame = -3 Query: 138 NPYGGKTFEMHDCGSNADEARAKGCSYDVMMQEWTPPECIDWTLAE 1 NP GK DCG + EARAKGC YDVMMQ+W P C D L E Sbjct: 100 NPLAGKVL---DCGYSPTEARAKGCVYDVMMQDWVPEPCYDSLLTE 142