BLASTX nr result
ID: Magnolia22_contig00010139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00010139 (892 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT44131.1 putative U3 small nucleolar RNA-associated protein 11... 56 1e-05 >JAT44131.1 putative U3 small nucleolar RNA-associated protein 11 [Anthurium amnicola] Length = 200 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 292 RKNTSYRELEIKKKRVNQLEKLYMDMTLQKELQV 393 + TSYRELE +KKRVN LEKLYMDM LQKELQV Sbjct: 167 KMETSYRELEERKKRVNDLEKLYMDMVLQKELQV 200