BLASTX nr result
ID: Magnolia22_contig00008143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00008143 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019702611.1 PREDICTED: mitochondrial import receptor subunit ... 74 4e-15 XP_008809473.1 PREDICTED: mitochondrial import receptor subunit ... 74 4e-15 XP_020091465.1 mitochondrial import receptor subunit TOM6 homolo... 70 8e-14 OAY78853.1 Mitochondrial import receptor subunit TOM [Ananas com... 70 2e-12 KMZ59240.1 hypothetical protein ZOSMA_6G01740 [Zostera marina] 66 5e-12 XP_009419045.1 PREDICTED: mitochondrial import receptor subunit ... 65 8e-12 XP_010263834.1 PREDICTED: mitochondrial import receptor subunit ... 65 2e-11 XP_003631623.2 PREDICTED: mitochondrial import receptor subunit ... 64 4e-11 XP_009596562.1 PREDICTED: mitochondrial import receptor subunit ... 63 6e-11 XP_015063655.1 PREDICTED: mitochondrial import receptor subunit ... 62 1e-10 XP_002519115.1 PREDICTED: mitochondrial import receptor subunit ... 62 1e-10 XP_010096240.1 hypothetical protein L484_026977 [Morus notabilis... 62 2e-10 XP_009798301.1 PREDICTED: mitochondrial import receptor subunit ... 62 2e-10 XP_015900822.1 PREDICTED: mitochondrial import receptor subunit ... 61 3e-10 OAY25470.1 hypothetical protein MANES_17G097600 [Manihot esculenta] 61 5e-10 XP_019053064.1 PREDICTED: mitochondrial import receptor subunit ... 61 5e-10 XP_004230848.1 PREDICTED: mitochondrial import receptor subunit ... 60 7e-10 XP_016539703.1 PREDICTED: mitochondrial import receptor subunit ... 60 1e-09 ABK20892.1 unknown [Picea sitchensis] ABK23244.1 unknown [Picea ... 60 1e-09 XP_009618631.1 PREDICTED: mitochondrial import receptor subunit ... 60 1e-09 >XP_019702611.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Elaeis guineensis] Length = 54 Score = 73.9 bits (180), Expect = 4e-15 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQLKTHL IMGAWVAVIR+TPY+LHY Sbjct: 7 PRRPDKATAYKQLKTHLAIMGAWVAVIRVTPYILHY 42 >XP_008809473.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Phoenix dactylifera] Length = 54 Score = 73.9 bits (180), Expect = 4e-15 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQLKTHL IMGAWVAVIR+TPY+LHY Sbjct: 7 PRRPDKATAYKQLKTHLSIMGAWVAVIRVTPYILHY 42 >XP_020091465.1 mitochondrial import receptor subunit TOM6 homolog [Ananas comosus] Length = 54 Score = 70.5 bits (171), Expect = 8e-14 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQLKTHL IMG W+AVIR+TPY+LH+ Sbjct: 7 PRRPDKATAYKQLKTHLAIMGTWIAVIRVTPYILHF 42 >OAY78853.1 Mitochondrial import receptor subunit TOM [Ananas comosus] Length = 177 Score = 70.5 bits (171), Expect = 2e-12 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQLKTHL IMG W+AVIR+TPY+LH+ Sbjct: 7 PRRPDKATAYKQLKTHLAIMGTWIAVIRVTPYILHF 42 >KMZ59240.1 hypothetical protein ZOSMA_6G01740 [Zostera marina] Length = 53 Score = 65.9 bits (159), Expect = 5e-12 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRP+K AYKQL+TH+ IMG WVA+IR+TPYVLH+ Sbjct: 7 PRRPEKGAAYKQLRTHIAIMGVWVAIIRVTPYVLHF 42 >XP_009419045.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Musa acuminata subsp. malaccensis] Length = 54 Score = 65.5 bits (158), Expect = 8e-12 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQLK HL IMGA++ VIR+TPYVLHY Sbjct: 7 PRRPDKATAYKQLKRHLGIMGAFIVVIRVTPYVLHY 42 >XP_010263834.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nelumbo nucifera] Length = 54 Score = 64.7 bits (156), Expect = 2e-11 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PR+PDKA A KQL+TH+M+ G WVAV+R+TPY+LHY Sbjct: 7 PRKPDKATALKQLRTHVMMFGVWVAVVRVTPYILHY 42 >XP_003631623.2 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vitis vinifera] Length = 54 Score = 63.5 bits (153), Expect = 4e-11 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKAVA KQL+TH+++ GAWVAV+R+TPY+LHY Sbjct: 8 RKPDKAVALKQLRTHVVMFGAWVAVVRVTPYILHY 42 >XP_009596562.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] XP_009791420.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] XP_016446195.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] XP_016477444.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] XP_016477445.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] XP_019249059.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana attenuata] Length = 54 Score = 63.2 bits (152), Expect = 6e-11 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+ + GAWVAVIR+TPY+LHY Sbjct: 8 RKPDKAAALKQLKTHVALFGAWVAVIRVTPYILHY 42 >XP_015063655.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum pennellii] Length = 54 Score = 62.4 bits (150), Expect = 1e-10 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+++ G WVAVIR+TPY+LHY Sbjct: 8 RKPDKAAALKQLKTHVVLFGTWVAVIRVTPYILHY 42 >XP_002519115.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ricinus communis] EEF43326.1 conserved hypothetical protein [Ricinus communis] Length = 54 Score = 62.4 bits (150), Expect = 1e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH I GAWVA+IR+TPYVLHY Sbjct: 8 RKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHY 42 >XP_010096240.1 hypothetical protein L484_026977 [Morus notabilis] EXB63635.1 hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 61.6 bits (148), Expect = 2e-10 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQL+TH+ + GAWVAVIR+TPY+LHY Sbjct: 8 RKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHY 42 >XP_009798301.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] XP_016455397.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] Length = 54 Score = 61.6 bits (148), Expect = 2e-10 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+ + G WVAVIR+TPY+LHY Sbjct: 8 RKPDKAAALKQLKTHVALFGTWVAVIRVTPYILHY 42 >XP_015900822.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ziziphus jujuba] XP_015902888.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ziziphus jujuba] Length = 54 Score = 61.2 bits (147), Expect = 3e-10 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDK A KQL+TH+ I GAWVAVIR+TPYVLHY Sbjct: 8 RKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHY 42 >OAY25470.1 hypothetical protein MANES_17G097600 [Manihot esculenta] Length = 54 Score = 60.8 bits (146), Expect = 5e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+ + G WVAV+R+TPY+LHY Sbjct: 8 RKPDKAAALKQLKTHVSMFGVWVAVVRVTPYILHY 42 >XP_019053064.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nelumbo nucifera] Length = 54 Score = 60.8 bits (146), Expect = 5e-10 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PR+PDKA A KQL TH+ I G WVAV+R TPYVLHY Sbjct: 7 PRKPDKAAALKQLTTHVTIFGIWVAVVRATPYVLHY 42 >XP_004230848.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] XP_006365492.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 60.5 bits (145), Expect = 7e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+++ G WVAVIR+ PY+LHY Sbjct: 8 RKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHY 42 >XP_016539703.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] XP_016539705.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] Length = 54 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+ + GAWV IR+TPY+LHY Sbjct: 8 RKPDKAAALKQLKTHVALFGAWVVAIRVTPYILHY 42 >ABK20892.1 unknown [Picea sitchensis] ABK23244.1 unknown [Picea sitchensis] ABK25295.1 unknown [Picea sitchensis] Length = 55 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 3 PRRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 PRRPDKA AYKQL+ HL ++G WVA IR+ PYV H+ Sbjct: 7 PRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPYVAHF 42 >XP_009618631.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] XP_016455530.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] XP_019255608.1 PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana attenuata] Length = 54 Score = 59.7 bits (143), Expect = 1e-09 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 6 RRPDKAVAYKQLKTHLMIMGAWVAVIRITPYVLHY 110 R+PDKA A KQLKTH+ + G WVAVIR+ PY+LHY Sbjct: 8 RKPDKAAALKQLKTHVALFGTWVAVIRVAPYILHY 42