BLASTX nr result
ID: Magnolia22_contig00008119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00008119 (868 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018037960.1 hypothetical protein CC84DRAFT_1258657 [Paraphaeo... 64 7e-09 KZM20666.1 hypothetical protein ST47_g8174 [Ascochyta rabiei] 57 3e-06 >XP_018037960.1 hypothetical protein CC84DRAFT_1258657 [Paraphaeosphaeria sporulosa] OAG07595.1 hypothetical protein CC84DRAFT_1258657 [Paraphaeosphaeria sporulosa] Length = 161 Score = 63.9 bits (154), Expect = 7e-09 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = +2 Query: 302 PPACLIGAISKQDNPADIKSICSDSDPVTSYLSKNCGGNEQDALDAFKSTCKD 460 PP CL+GA++ D P+DIK++CS D +TS +S+NCG QDAL+A C D Sbjct: 23 PPGCLLGAVNSYDTPSDIKAVCSAKD-ITSQISQNCGDKAQDALNALADICND 74 >KZM20666.1 hypothetical protein ST47_g8174 [Ascochyta rabiei] Length = 165 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = +2 Query: 302 PPACLIGAISKQDNPADIKSICSDSDPVTSYLSKNCGGNEQDALDAFKSTCKD 460 PP CL+GA+++ NPAD+KS+C D D T ++ CG + + AL AF C D Sbjct: 22 PPGCLLGAVNEYANPADMKSVCKDKDAATK-IASACGDDTKAALSAFAEVCAD 73