BLASTX nr result
ID: Magnolia22_contig00007923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007923 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018188688.1 hypothetical protein L228DRAFT_105000 [Xylona hev... 67 3e-11 >XP_018188688.1 hypothetical protein L228DRAFT_105000 [Xylona heveae TC161] KZF23133.1 hypothetical protein L228DRAFT_105000 [Xylona heveae TC161] Length = 178 Score = 66.6 bits (161), Expect = 3e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 234 LMSVDLRASRTCLRFPSRVVTVSRAQLSSVHTGDLTRPVDS 112 LMSVD R SRTCLRFP+RV +SR+QLSSVHTGDLTRP ++ Sbjct: 137 LMSVDSRLSRTCLRFPARVENISRSQLSSVHTGDLTRPAEN 177