BLASTX nr result
ID: Magnolia22_contig00007772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007772 (525 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIW67059.1 GTP-binding protein rhoA [Capronia semi-immersa] KIW6... 124 1e-32 OAL26599.1 GTP-binding protein rhoA [Fonsecaea nubica] 122 9e-32 XP_007758163.1 rho family, other [Cladophialophora yegresii CBS ... 122 9e-32 KIV79079.1 GTP-binding protein rhoA [Exophiala sideris] KIV79080... 120 5e-31 XP_013259051.1 GTP-binding protein rhoA [Exophiala aquamarina CB... 119 1e-30 XP_007738157.1 GTP-binding protein rhoA [Capronia epimyces CBS 6... 119 1e-30 XP_016230814.1 GTP-binding protein rhoA [Exophiala spinifera] XP... 118 2e-30 XP_007725637.1 GTP-binding protein rhoA [Capronia coronata CBS 6... 118 2e-30 XP_009156554.1 GTP-binding protein rhoA [Exophiala dermatitidis ... 118 2e-30 XP_008711621.1 GTP-binding protein rhoA [Cyphellophora europaea ... 118 3e-30 XP_016220666.1 GTP-binding protein rhoA [Exophiala mesophila] KI... 115 3e-29 XP_017998740.1 GTP-binding protein rhoA [Phialophora attae] KPI3... 113 3e-28 KFY24752.1 hypothetical protein V493_05046 [Pseudogymnoascus sp.... 112 5e-28 KFX92705.1 hypothetical protein V490_05226 [Pseudogymnoascus sp.... 112 5e-28 OBT53650.1 GTP-binding protein rhoA [Pseudogymnoascus sp. 24MN13] 110 1e-27 OBT63957.1 GTP-binding protein rhoA [Pseudogymnoascus sp. 23342-... 111 1e-27 KFY05611.1 hypothetical protein V492_08408, partial [Pseudogymno... 110 2e-27 XP_018130535.1 GTP-binding protein rhoA [Pseudogymnoascus verruc... 110 4e-27 KUI74001.1 GTP-binding protein rhoA [Valsa mali] 109 8e-27 KFY13800.1 hypothetical protein V491_06272 [Pseudogymnoascus sp.... 108 1e-26 >KIW67059.1 GTP-binding protein rhoA [Capronia semi-immersa] KIW67060.1 GTP-binding protein rhoA, variant [Capronia semi-immersa] Length = 193 Score = 124 bits (311), Expect = 1e-32 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >OAL26599.1 GTP-binding protein rhoA [Fonsecaea nubica] Length = 193 Score = 122 bits (305), Expect = 9e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRK GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKSGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >XP_007758163.1 rho family, other [Cladophialophora yegresii CBS 114405] XP_007747421.1 rho family, other [Cladophialophora psammophila CBS 110553] XP_008729116.1 GTP-binding protein rhoA [Cladophialophora carrionii CBS 160.54] XP_013275237.1 GTP-binding protein rhoA [Rhinocladiella mackenziei CBS 650.93] XP_013289360.1 GTP-binding protein rhoA [Fonsecaea pedrosoi CBS 271.37] XP_013313491.1 GTP-binding protein rhoA, variant [Exophiala xenobiotica] XP_013313492.1 GTP-binding protein rhoA [Exophiala xenobiotica] XP_016252389.1 GTP-binding protein rhoA [Cladophialophora immunda] XP_016622091.1 GTP-binding protein rhoA [Cladophialophora bantiana CBS 173.52] XP_016629702.1 GTP-binding protein rhoA [Fonsecaea multimorphosa CBS 102226] XP_018693952.1 GTP-binding protein rhoA [Fonsecaea erecta] ETI22499.1 GTP-binding protein rhoA [Cladophialophora carrionii CBS 160.54] EXJ58540.1 rho family, other [Cladophialophora yegresii CBS 114405] EXJ68035.1 rho family, other [Cladophialophora psammophila CBS 110553] KIW32173.1 GTP-binding protein rhoA [Cladophialophora immunda] KIW52907.1 GTP-binding protein rhoA [Exophiala xenobiotica] KIW52908.1 GTP-binding protein rhoA, variant [Exophiala xenobiotica] KIW85552.1 GTP-binding protein rhoA [Fonsecaea pedrosoi CBS 271.37] KIW95422.1 GTP-binding protein rhoA [Cladophialophora bantiana CBS 173.52] KIX08101.1 GTP-binding protein rhoA [Rhinocladiella mackenziei CBS 650.93] KIX95579.1 GTP-binding protein rhoA [Fonsecaea multimorphosa CBS 102226] OAG41678.1 GTP-binding protein rhoA [Fonsecaea monophora] OAL21186.1 GTP-binding protein rhoA [Fonsecaea multimorphosa] OAP60585.1 GTP-binding protein rhoA [Fonsecaea erecta] OCT51515.1 GTP-binding protein rhoA [Cladophialophora carrionii] Length = 193 Score = 122 bits (305), Expect = 9e-32 Identities = 60/62 (96%), Positives = 61/62 (98%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRK GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKSGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >KIV79079.1 GTP-binding protein rhoA [Exophiala sideris] KIV79080.1 GTP-binding protein rhoA, variant [Exophiala sideris] Length = 193 Score = 120 bits (300), Expect = 5e-31 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN GVREVFESATRAALLTRK GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNHGVREVFESATRAALLTRKSGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >XP_013259051.1 GTP-binding protein rhoA [Exophiala aquamarina CBS 119918] KEF56461.1 GTP-binding protein rhoA [Exophiala aquamarina CBS 119918] Length = 189 Score = 119 bits (297), Expect = 1e-30 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVT EQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRK GKSKKCL Sbjct: 128 AKTSQKPVTAEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKSGKSKKCL 187 Query: 343 VL 338 +L Sbjct: 188 IL 189 >XP_007738157.1 GTP-binding protein rhoA [Capronia epimyces CBS 606.96] EXJ77647.1 GTP-binding protein rhoA [Capronia epimyces CBS 606.96] Length = 216 Score = 119 bits (299), Expect = 1e-30 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKT QGVREVFESATRAALLTRK GKSKKCL Sbjct: 155 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTGQGVREVFESATRAALLTRKSGKSKKCL 214 Query: 343 VL 338 +L Sbjct: 215 IL 216 >XP_016230814.1 GTP-binding protein rhoA [Exophiala spinifera] XP_016266812.1 GTP-binding protein rhoA [Exophiala oligosperma] KIW10598.1 GTP-binding protein rhoA [Exophiala spinifera] KIW46596.1 GTP-binding protein rhoA [Exophiala oligosperma] Length = 193 Score = 118 bits (296), Expect = 2e-30 Identities = 59/62 (95%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTR GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRGRGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >XP_007725637.1 GTP-binding protein rhoA [Capronia coronata CBS 617.96] EXJ86199.1 GTP-binding protein rhoA [Capronia coronata CBS 617.96] Length = 193 Score = 118 bits (296), Expect = 2e-30 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKT +GVREVFESATRAALLTRK GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTGEGVREVFESATRAALLTRKSGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >XP_009156554.1 GTP-binding protein rhoA [Exophiala dermatitidis NIH/UT8656] ADQ48102.1 RHO1 [Exophiala dermatitidis] EHY56093.1 GTP-binding protein rhoA [Exophiala dermatitidis NIH/UT8656] Length = 193 Score = 118 bits (296), Expect = 2e-30 Identities = 58/62 (93%), Positives = 60/62 (96%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCL 344 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKT QGVREVFE+ATRAALLTRK GKSKKCL Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTGQGVREVFETATRAALLTRKSGKSKKCL 191 Query: 343 VL 338 +L Sbjct: 192 IL 193 >XP_008711621.1 GTP-binding protein rhoA [Cyphellophora europaea CBS 101466] ETN46909.1 GTP-binding protein rhoA [Cyphellophora europaea CBS 101466] Length = 193 Score = 118 bits (295), Expect = 3e-30 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCLV 341 KTSQKPV PEQGEEVRKKIGAYKYLECSAKTN GVREVFESATRAALLTRKGGKSKKCL+ Sbjct: 133 KTSQKPVGPEQGEEVRKKIGAYKYLECSAKTNHGVREVFESATRAALLTRKGGKSKKCLI 192 Query: 340 L 338 L Sbjct: 193 L 193 >XP_016220666.1 GTP-binding protein rhoA [Exophiala mesophila] KIV89092.1 GTP-binding protein rhoA [Exophiala mesophila] Length = 194 Score = 115 bits (288), Expect = 3e-29 Identities = 58/63 (92%), Positives = 61/63 (96%), Gaps = 1/63 (1%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRK-GGKSKKC 347 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRK G +SKKC Sbjct: 132 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKSGSRSKKC 191 Query: 346 LVL 338 ++L Sbjct: 192 MIL 194 >XP_017998740.1 GTP-binding protein rhoA [Phialophora attae] KPI38777.1 GTP-binding protein rhoA [Phialophora attae] Length = 205 Score = 113 bits (282), Expect = 3e-28 Identities = 57/63 (90%), Positives = 59/63 (93%), Gaps = 1/63 (1%) Frame = -3 Query: 523 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSK-KC 347 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN GVREVFESATRAALLTRK GK K KC Sbjct: 143 AKTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNHGVREVFESATRAALLTRKSGKGKHKC 202 Query: 346 LVL 338 ++L Sbjct: 203 MIL 205 >KFY24752.1 hypothetical protein V493_05046 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] Length = 193 Score = 112 bits (280), Expect = 5e-28 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSKKCLV 341 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGGK KKC + Sbjct: 133 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKKKKCFI 192 >KFX92705.1 hypothetical protein V490_05226 [Pseudogymnoascus sp. VKM F-3557] KFX93126.1 hypothetical protein O988_06976 [Pseudogymnoascus sp. VKM F-3808] KFY38274.1 hypothetical protein V495_06671 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY52069.1 hypothetical protein V497_08664 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY52921.1 hypothetical protein V496_08058 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY88024.1 hypothetical protein V500_06624 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFY95062.1 hypothetical protein V498_03534 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] KFZ16643.1 hypothetical protein V502_04995 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] Length = 194 Score = 112 bits (280), Expect = 5e-28 Identities = 56/62 (90%), Positives = 60/62 (96%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSK-KCL 344 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGGKSK KCL Sbjct: 133 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKSKHKCL 192 Query: 343 VL 338 +L Sbjct: 193 IL 194 >OBT53650.1 GTP-binding protein rhoA [Pseudogymnoascus sp. 24MN13] Length = 153 Score = 110 bits (274), Expect = 1e-27 Identities = 55/62 (88%), Positives = 59/62 (95%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGG-KSKKCL 344 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGG KS KCL Sbjct: 92 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKKSHKCL 151 Query: 343 VL 338 +L Sbjct: 152 IL 153 >OBT63957.1 GTP-binding protein rhoA [Pseudogymnoascus sp. 23342-1-I1] Length = 194 Score = 111 bits (277), Expect = 1e-27 Identities = 55/62 (88%), Positives = 60/62 (96%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSK-KCL 344 KTSQKPVTP+QGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGGKSK KCL Sbjct: 133 KTSQKPVTPDQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKSKHKCL 192 Query: 343 VL 338 +L Sbjct: 193 IL 194 >KFY05611.1 hypothetical protein V492_08408, partial [Pseudogymnoascus sp. VKM F-4246] KFY33656.1 hypothetical protein V494_07431, partial [Pseudogymnoascus sp. VKM F-4513 (FW-928)] Length = 162 Score = 110 bits (274), Expect = 2e-27 Identities = 55/62 (88%), Positives = 59/62 (95%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSK-KCL 344 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGGKSK KC Sbjct: 101 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKSKHKCR 160 Query: 343 VL 338 +L Sbjct: 161 IL 162 >XP_018130535.1 GTP-binding protein rhoA [Pseudogymnoascus verrucosus] KFY73712.1 hypothetical protein V499_06210 [Pseudogymnoascus sp. VKM F-103] KFZ10855.1 hypothetical protein V501_05016 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] OBT96802.1 GTP-binding protein rhoA [Pseudogymnoascus verrucosus] Length = 194 Score = 110 bits (274), Expect = 4e-27 Identities = 55/62 (88%), Positives = 59/62 (95%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGG-KSKKCL 344 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGG KS KCL Sbjct: 133 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKKSHKCL 192 Query: 343 VL 338 +L Sbjct: 193 IL 194 >KUI74001.1 GTP-binding protein rhoA [Valsa mali] Length = 194 Score = 109 bits (272), Expect = 8e-27 Identities = 55/62 (88%), Positives = 58/62 (93%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGG-KSKKCL 344 KTSQKPVTPE+GEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL RKGG K +KCL Sbjct: 133 KTSQKPVTPEEGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLQRKGGIKKRKCL 192 Query: 343 VL 338 VL Sbjct: 193 VL 194 >KFY13800.1 hypothetical protein V491_06272 [Pseudogymnoascus sp. VKM F-3775] Length = 194 Score = 108 bits (271), Expect = 1e-26 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 1/62 (1%) Frame = -3 Query: 520 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNQGVREVFESATRAALLTRKGGKSK-KCL 344 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTN+GVREVFE ATRAALL++KGGK+K KC Sbjct: 133 KTSQKPVTPEQGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALLSKKGGKTKHKCR 192 Query: 343 VL 338 +L Sbjct: 193 IL 194