BLASTX nr result
ID: Magnolia22_contig00007617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007617 (654 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013264445.1 hypothetical protein A1O9_03426 [Exophiala aquama... 124 1e-33 XP_008717781.1 hypothetical protein HMPREF1541_05218 [Cyphelloph... 124 3e-33 XP_018690263.1 hypothetical protein AYL99_09008 [Fonsecaea erect... 123 4e-33 XP_013279484.1 hypothetical protein Z517_10418 [Fonsecaea pedros... 122 8e-33 XP_016623574.1 hypothetical protein Z519_02296 [Cladophialophora... 120 7e-32 XP_016632087.1 hypothetical protein Z520_06042 [Fonsecaea multim... 119 1e-31 XP_007743260.1 hypothetical protein A1O5_04464 [Cladophialophora... 119 2e-31 XP_016237146.1 hypothetical protein PV08_04120 [Exophiala spinif... 118 5e-31 XP_018002421.1 hypothetical protein AB675_9582 [Phialophora atta... 117 1e-30 XP_013277339.1 hypothetical protein Z518_01284 [Rhinocladiella m... 116 2e-30 XP_013317909.1 hypothetical protein PV05_05890 [Exophiala xenobi... 116 3e-30 XP_016267815.1 hypothetical protein PV06_00282 [Exophiala oligos... 115 8e-30 XP_009157359.1 hypothetical protein HMPREF1120_04962 [Exophiala ... 112 9e-29 XP_007727741.1 hypothetical protein A1O1_08693 [Capronia coronat... 112 1e-28 KIV85261.1 hypothetical protein PV11_00981 [Exophiala sideris] 111 2e-28 XP_007736371.1 hypothetical protein A1O3_08082 [Capronia epimyce... 110 5e-28 XP_003017146.1 hypothetical protein ARB_04022 [Trichophyton benh... 106 2e-26 XP_003234950.1 NADH-ubiquinone oxidoreductase B12 subunit [Trich... 106 2e-26 XP_002844989.1 conserved hypothetical protein [Arthroderma otae ... 106 2e-26 KIW71372.1 hypothetical protein PV04_03549 [Capronia semi-immersa] 105 7e-26 >XP_013264445.1 hypothetical protein A1O9_03426 [Exophiala aquamarina CBS 119918] KEF61855.1 hypothetical protein A1O9_03426 [Exophiala aquamarina CBS 119918] Length = 86 Score = 124 bits (312), Expect = 1e-33 Identities = 55/75 (73%), Positives = 61/75 (81%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGA 280 MAPPNPTGFD+KAF NAATS+EWR++DPW R EAWRY GPFTRWNRFKG+FPG GI A Sbjct: 1 MAPPNPTGFDMKAFTNAATSREWRAKDPWVRNEAWRYNGPFTRWNRFKGSFPGLGIATVA 60 Query: 281 FLVYWAFESTFLKQS 325 F Y FE+ FLK S Sbjct: 61 FAGYVIFEAMFLKDS 75 >XP_008717781.1 hypothetical protein HMPREF1541_05218 [Cyphellophora europaea CBS 101466] ETN40938.1 hypothetical protein HMPREF1541_05218 [Cyphellophora europaea CBS 101466] Length = 86 Score = 124 bits (310), Expect = 3e-33 Identities = 53/73 (72%), Positives = 59/73 (80%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGA 280 MAPPNPTGFD+K F A+TS +WRS+DPW+R EAWR TGPFTRWNRFKGAFPGFGI +GA Sbjct: 1 MAPPNPTGFDMKEFVRASTSTQWRSKDPWKRNEAWRSTGPFTRWNRFKGAFPGFGIAVGA 60 Query: 281 FLVYWAFESTFLK 319 F VY E F K Sbjct: 61 FAVYLVAEQVFFK 73 >XP_018690263.1 hypothetical protein AYL99_09008 [Fonsecaea erecta] OAP56896.1 hypothetical protein AYL99_09008 [Fonsecaea erecta] Length = 88 Score = 123 bits (309), Expect = 4e-33 Identities = 57/76 (75%), Positives = 62/76 (81%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF +KAF +AATS+EWR+RDPW R EAWRYTGPFTRWNRFKGAFPGFGI + Sbjct: 1 MAPPNNPTGFSMKAFTDAATSKEWRARDPWSRYEAWRYTGPFTRWNRFKGAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK S Sbjct: 61 AFTGYVIFEQLFLKDS 76 >XP_013279484.1 hypothetical protein Z517_10418 [Fonsecaea pedrosoi CBS 271.37] KIW75676.1 hypothetical protein Z517_10418 [Fonsecaea pedrosoi CBS 271.37] Length = 88 Score = 122 bits (307), Expect = 8e-33 Identities = 56/76 (73%), Positives = 63/76 (82%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPP-NPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPP NPTGF +KAF +AATS+EWR+RDPW R EAWRYTGPF+RWNRFKGAFPGFGI + Sbjct: 1 MAPPSNPTGFSMKAFTDAATSKEWRARDPWSRHEAWRYTGPFSRWNRFKGAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK+S Sbjct: 61 AFTGYVIFEQLFLKES 76 >XP_016623574.1 hypothetical protein Z519_02296 [Cladophialophora bantiana CBS 173.52] KIW96905.1 hypothetical protein Z519_02296 [Cladophialophora bantiana CBS 173.52] Length = 88 Score = 120 bits (301), Expect = 7e-32 Identities = 56/76 (73%), Positives = 61/76 (80%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF +KAF +AATS+EWR+RDPW R EAWRYTGPFTRWNRFK AFPGFGI + Sbjct: 1 MAPPNNPTGFSMKAFTDAATSKEWRARDPWARHEAWRYTGPFTRWNRFKRAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK S Sbjct: 61 AFTGYVIFEQLFLKDS 76 >XP_016632087.1 hypothetical protein Z520_06042 [Fonsecaea multimorphosa CBS 102226] KIX97964.1 hypothetical protein Z520_06042 [Fonsecaea multimorphosa CBS 102226] Length = 88 Score = 119 bits (299), Expect = 1e-31 Identities = 56/76 (73%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF +KAF +AATS+EWR RDPW R EAWRYTGPFTRWNRFK AFPGFGI + Sbjct: 1 MAPPNNPTGFSMKAFTDAATSREWRQRDPWGRYEAWRYTGPFTRWNRFKRAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK S Sbjct: 61 AFTGYVIFEQLFLKDS 76 >XP_007743260.1 hypothetical protein A1O5_04464 [Cladophialophora psammophila CBS 110553] EXJ71962.1 hypothetical protein A1O5_04464 [Cladophialophora psammophila CBS 110553] Length = 88 Score = 119 bits (298), Expect = 2e-31 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF +KAF +AATS++WR+RDPW R EAWRYTGPFTRWNRFK AFPGFGI + Sbjct: 1 MAPPNNPTGFSMKAFTDAATSKQWRARDPWARHEAWRYTGPFTRWNRFKRAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK S Sbjct: 61 AFTGYVIFEQLFLKDS 76 >XP_016237146.1 hypothetical protein PV08_04120 [Exophiala spinifera] KIW16930.1 hypothetical protein PV08_04120 [Exophiala spinifera] Length = 87 Score = 118 bits (295), Expect = 5e-31 Identities = 53/76 (69%), Positives = 61/76 (80%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPP-NPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPP NPTGF++K F +AATS +WR++DPW + EAWRYTGPFTRWNRFKGAFPGFGI + Sbjct: 1 MAPPTNPTGFNMKTFTDAATSPQWRAKDPWAKNEAWRYTGPFTRWNRFKGAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE FLK S Sbjct: 61 AFTGYVIFEQLFLKDS 76 >XP_018002421.1 hypothetical protein AB675_9582 [Phialophora attae] KPI42458.1 hypothetical protein AB675_9582 [Phialophora attae] Length = 87 Score = 117 bits (292), Expect = 1e-30 Identities = 51/71 (71%), Positives = 56/71 (78%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGA 280 MAPPNPTGF+IK F A+TS +WRS+DPW+R E WRYTGPFTRWNRFKGAFPGFGI A Sbjct: 1 MAPPNPTGFEIKEFVRASTSAQWRSKDPWKRNEIWRYTGPFTRWNRFKGAFPGFGIAAVA 60 Query: 281 FLVYWAFESTF 313 F VY E F Sbjct: 61 FGVYVVAEQLF 71 >XP_013277339.1 hypothetical protein Z518_01284 [Rhinocladiella mackenziei CBS 650.93] KIX10203.1 hypothetical protein Z518_01284 [Rhinocladiella mackenziei CBS 650.93] Length = 84 Score = 116 bits (291), Expect = 2e-30 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 2/75 (2%) Frame = +2 Query: 107 PP--NPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGA 280 PP NPTGF++K F +AATS++WR++DPW R+EAWRYTGPFTRWNRFKGAFPGFGI A Sbjct: 2 PPSNNPTGFNMKTFTDAATSKQWRAKDPWARSEAWRYTGPFTRWNRFKGAFPGFGIAAVA 61 Query: 281 FLVYWAFESTFLKQS 325 F Y FE+ F+K S Sbjct: 62 FTGYVVFEALFMKDS 76 >XP_013317909.1 hypothetical protein PV05_05890 [Exophiala xenobiotica] KIW57325.1 hypothetical protein PV05_05890 [Exophiala xenobiotica] Length = 87 Score = 116 bits (290), Expect = 3e-30 Identities = 52/76 (68%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF++K F +AATS +WR++DPW R EAWRY+GPFTRWNR KGAFPGFGI Sbjct: 1 MAPPNNPTGFNMKTFTDAATSPQWRAKDPWARGEAWRYSGPFTRWNRLKGAFPGFGIAAV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE+ FLK S Sbjct: 61 AFTGYVIFEAVFLKDS 76 >XP_016267815.1 hypothetical protein PV06_00282 [Exophiala oligosperma] KIW47599.1 hypothetical protein PV06_00282 [Exophiala oligosperma] Length = 87 Score = 115 bits (287), Expect = 8e-30 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPP-NPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAP NPTGF++K F +AATS +WR++DPW + EAWRYTGPFTRWNRFKGAFPGFGI + Sbjct: 1 MAPSTNPTGFNMKTFTDAATSPQWRAKDPWAKNEAWRYTGPFTRWNRFKGAFPGFGIAVV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y FE F+K+S Sbjct: 61 AFTGYVIFEQLFMKES 76 >XP_009157359.1 hypothetical protein HMPREF1120_04962 [Exophiala dermatitidis NIH/UT8656] EHY56898.1 hypothetical protein HMPREF1120_04962 [Exophiala dermatitidis NIH/UT8656] Length = 88 Score = 112 bits (280), Expect = 9e-29 Identities = 52/76 (68%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAP N PTGFD+K F +AATS+EWR+RDPW R EAWRYTGPFTRWNRFK AFPG GI Sbjct: 1 MAPSNNPTGFDMKTFTDAATSREWRARDPWARNEAWRYTGPFTRWNRFKRAFPGLGIATA 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y E+ F K S Sbjct: 61 AFTGYVIVEALFFKDS 76 >XP_007727741.1 hypothetical protein A1O1_08693 [Capronia coronata CBS 617.96] EXJ80547.1 hypothetical protein A1O1_08693 [Capronia coronata CBS 617.96] Length = 88 Score = 112 bits (279), Expect = 1e-28 Identities = 48/74 (64%), Positives = 57/74 (77%) Frame = +2 Query: 104 APPNPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGAF 283 +P NPTGF++K F +AATS+EWR+RDPW + E WR+TGPFTRWNR KGAFPG GI AF Sbjct: 3 SPNNPTGFNMKTFTDAATSREWRARDPWAKNETWRHTGPFTRWNRLKGAFPGLGIATAAF 62 Query: 284 LVYWAFESTFLKQS 325 Y FE+ FLK S Sbjct: 63 AGYVIFEALFLKDS 76 >KIV85261.1 hypothetical protein PV11_00981 [Exophiala sideris] Length = 88 Score = 111 bits (278), Expect = 2e-28 Identities = 49/71 (69%), Positives = 56/71 (78%) Frame = +2 Query: 113 NPTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLGAFLVY 292 NPTGFD+K F +AATS+EWR+RDPW R+EAWRYTGPFTRWNR K AFPG GI AF Y Sbjct: 6 NPTGFDMKTFTDAATSREWRARDPWARSEAWRYTGPFTRWNRMKRAFPGLGIATVAFTGY 65 Query: 293 WAFESTFLKQS 325 FE+ FL +S Sbjct: 66 VIFEALFLNKS 76 >XP_007736371.1 hypothetical protein A1O3_08082 [Capronia epimyces CBS 606.96] EXJ79797.1 hypothetical protein A1O3_08082 [Capronia epimyces CBS 606.96] Length = 88 Score = 110 bits (275), Expect = 5e-28 Identities = 50/76 (65%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAP N PTGF++K F NAATS+EWR++DPW R EAWRYTGPFTRWNRFK AFPG GI Sbjct: 1 MAPSNNPTGFNMKTFTNAATSREWRAKDPWARNEAWRYTGPFTRWNRFKRAFPGLGIATA 60 Query: 278 AFLVYWAFESTFLKQS 325 AF Y E+ F K + Sbjct: 61 AFTGYVIIEALFFKDT 76 >XP_003017146.1 hypothetical protein ARB_04022 [Trichophyton benhamiae CBS 112371] XP_003020524.1 hypothetical protein TRV_05378 [Trichophyton verrucosum HKI 0517] EFE36501.1 hypothetical protein ARB_04022 [Trichophyton benhamiae CBS 112371] EFE39906.1 hypothetical protein TRV_05378 [Trichophyton verrucosum HKI 0517] EZF34945.1 hypothetical protein H101_01508 [Trichophyton interdigitale H6] DAA79288.1 TPA_exp: Uncharacterized protein A8136_0061 [Trichophyton benhamiae CBS 112371] Length = 86 Score = 106 bits (265), Expect = 2e-26 Identities = 47/76 (61%), Positives = 55/76 (72%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAAT-SQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPNPTGFD+K F AA+ + EW RDPW+R EAWRYTGPF+RWNRFK FPG GI Sbjct: 1 MAPPNPTGFDMKTFKAAASPTSEWALRDPWKRHEAWRYTGPFSRWNRFKTGFPGLGIATV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF +Y +E FL + Sbjct: 61 AFAIYCGYEYAFLNDN 76 >XP_003234950.1 NADH-ubiquinone oxidoreductase B12 subunit [Trichophyton rubrum CBS 118892] EGD87755.1 hypothetical protein TERG_04001 [Trichophyton rubrum CBS 118892] EZF23022.1 hypothetical protein H100_04228 [Trichophyton rubrum MR850] EZF42108.1 hypothetical protein H102_04215 [Trichophyton rubrum CBS 100081] EZF52763.1 hypothetical protein H103_04223 [Trichophyton rubrum CBS 288.86] EZF63364.1 hypothetical protein H104_04212 [Trichophyton rubrum CBS 289.86] EZF73901.1 hypothetical protein H105_04240 [Trichophyton soudanense CBS 452.61] EZF84677.1 hypothetical protein H110_04217 [Trichophyton rubrum MR1448] EZF95426.1 hypothetical protein H113_04256 [Trichophyton rubrum MR1459] EZG06254.1 hypothetical protein H106_04039 [Trichophyton rubrum CBS 735.88] EZG16736.1 hypothetical protein H107_04342 [Trichophyton rubrum CBS 202.88] KDB33832.1 hypothetical protein H112_04222 [Trichophyton rubrum D6] KMQ46664.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 [Trichophyton rubrum] OAL69861.1 NADH-ubiquinone oxidoreductase B12 subunit [Trichophyton violaceum] Length = 86 Score = 106 bits (265), Expect = 2e-26 Identities = 47/76 (61%), Positives = 55/76 (72%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAAT-SQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPNPTGFD+K F AA+ + EW RDPW+R EAWRYTGPF+RWNRFK FPG GI Sbjct: 1 MAPPNPTGFDMKTFKAAASPTSEWALRDPWKRHEAWRYTGPFSRWNRFKTGFPGLGIATV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF +Y +E FL + Sbjct: 61 AFAIYCGYEYAFLNDN 76 >XP_002844989.1 conserved hypothetical protein [Arthroderma otae CBS 113480] XP_003173475.1 hypothetical protein MGYG_03652 [Nannizzia gypsea CBS 118893] EEQ34134.1 conserved hypothetical protein [Arthroderma otae CBS 113480] EFR00645.1 hypothetical protein MGYG_03652 [Nannizzia gypsea CBS 118893] Length = 86 Score = 106 bits (265), Expect = 2e-26 Identities = 47/76 (61%), Positives = 55/76 (72%), Gaps = 1/76 (1%) Frame = +2 Query: 101 MAPPNPTGFDIKAFANAAT-SQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPNPTGFD+K F AA+ + EW RDPW+R EAWRYTGPF+RWNRFK FPG GI Sbjct: 1 MAPPNPTGFDMKTFKAAASPTSEWALRDPWKRNEAWRYTGPFSRWNRFKTGFPGLGIATV 60 Query: 278 AFLVYWAFESTFLKQS 325 AF +Y +E FL + Sbjct: 61 AFAIYCGYEYAFLNDN 76 >KIW71372.1 hypothetical protein PV04_03549 [Capronia semi-immersa] Length = 89 Score = 105 bits (261), Expect = 7e-26 Identities = 48/72 (66%), Positives = 55/72 (76%), Gaps = 1/72 (1%) Frame = +2 Query: 101 MAPPN-PTGFDIKAFANAATSQEWRSRDPWRRAEAWRYTGPFTRWNRFKGAFPGFGIGLG 277 MAPPN PTGF +K F +AATS +WR++DPW+R EAWRYTGPFTR NR KGAFPGFGI + Sbjct: 1 MAPPNNPTGFSMKTFTDAATSTQWRAKDPWKRNEAWRYTGPFTRGNRMKGAFPGFGIAVV 60 Query: 278 AFLVYWAFESTF 313 AF Y E F Sbjct: 61 AFTGYVIVEQLF 72