BLASTX nr result
ID: Magnolia22_contig00007615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007615 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006387832.1 hypothetical protein POPTR_0535s00220g, partial [... 62 6e-10 GAV81629.1 hypothetical protein CFOL_v3_25083, partial [Cephalot... 57 5e-08 XP_018719294.1 PREDICTED: uncharacterized protein LOC108955652 [... 60 7e-08 XP_006388324.1 hypothetical protein POPTR_0229s00250g [Populus t... 58 2e-07 XP_011015163.1 PREDICTED: uncharacterized protein LOC105118819 [... 58 3e-07 KCW45836.1 hypothetical protein EUGRSUZ_L00350 [Eucalyptus grandis] 57 5e-07 XP_011459809.1 PREDICTED: uncharacterized protein LOC105350104 [... 56 2e-06 XP_007203374.1 hypothetical protein PRUPE_ppa025932mg [Prunus pe... 55 4e-06 XP_007207970.1 hypothetical protein PRUPE_ppa016339mg, partial [... 55 5e-06 XP_011457549.1 PREDICTED: geraniol 8-hydroxylase-like [Fragaria ... 55 5e-06 XP_016649787.1 PREDICTED: uncharacterized protein LOC103333039 [... 55 5e-06 XP_007220384.1 hypothetical protein PRUPE_ppa021778mg [Prunus pe... 55 5e-06 XP_007220740.1 hypothetical protein PRUPE_ppa023598mg [Prunus pe... 55 5e-06 XP_007210190.1 hypothetical protein PRUPE_ppa017790mg [Prunus pe... 55 5e-06 XP_007207232.1 hypothetical protein PRUPE_ppa026856mg [Prunus pe... 55 5e-06 XP_011465829.1 PREDICTED: uncharacterized protein LOC105351921 [... 54 9e-06 XP_015867559.1 PREDICTED: uncharacterized protein LOC107405062 [... 54 9e-06 XP_007216161.1 hypothetical protein PRUPE_ppa015308mg, partial [... 54 9e-06 >XP_006387832.1 hypothetical protein POPTR_0535s00220g, partial [Populus trichocarpa] ERP46746.1 hypothetical protein POPTR_0535s00220g, partial [Populus trichocarpa] Length = 104 Score = 62.0 bits (149), Expect = 6e-10 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = +2 Query: 194 EDVGHNNKEIDNMILQYPERGSDRVDWMDREFRMKVNLPNFNGQLHIKDFLDWLIEIEHF 373 ED+ ++E IL+ RG R + FRMK++LP+FNGQL IK LDWL+ +E F Sbjct: 9 EDILSEDEEEAEAILRGNRRGYQR-EPDQHMFRMKMDLPSFNGQLQIKGLLDWLVLVERF 67 Query: 374 FDSMDISEE 400 FD MDI E+ Sbjct: 68 FDYMDIPED 76 >GAV81629.1 hypothetical protein CFOL_v3_25083, partial [Cephalotus follicularis] Length = 121 Score = 57.4 bits (137), Expect = 5e-08 Identities = 28/73 (38%), Positives = 45/73 (61%) Frame = +2 Query: 185 VPLEDVGHNNKEIDNMILQYPERGSDRVDWMDREFRMKVNLPNFNGQLHIKDFLDWLIEI 364 VP+ED + + + Q P R + D ++R+K ++P FNG LH++DFLDW+ E Sbjct: 20 VPVEDSENEDDGGYGLYQQQPGRRNRDYD----DYRLKADIPAFNGCLHLEDFLDWISEE 75 Query: 365 EHFFDSMDISEEN 403 E FF+ MD+ +E+ Sbjct: 76 ESFFEMMDVPDES 88 >XP_018719294.1 PREDICTED: uncharacterized protein LOC108955652 [Eucalyptus grandis] Length = 975 Score = 60.1 bits (144), Expect = 7e-08 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +2 Query: 212 NKEIDNMILQYPERGSDRVDWMDRE---FRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDS 382 + E + L P RG R R+ +++KV+LP FNG L+I+DFLDWL E+E FFD+ Sbjct: 86 DSEGEEEFLDRPVRGGRRNRGYRRDPEQYQLKVDLPTFNGNLNIEDFLDWLWEVEKFFDA 145 Query: 383 MDISEE 400 M+I E+ Sbjct: 146 MEIEED 151 >XP_006388324.1 hypothetical protein POPTR_0229s00250g [Populus trichocarpa] ERP47238.1 hypothetical protein POPTR_0229s00250g [Populus trichocarpa] Length = 315 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +2 Query: 287 FRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISEE 400 FRMK++LPNFNGQL I+ FLDWL +E FFD M+I E+ Sbjct: 20 FRMKMDLPNFNGQLQIEGFLDWLAIVERFFDYMEIPED 57 >XP_011015163.1 PREDICTED: uncharacterized protein LOC105118819 [Populus euphratica] Length = 1026 Score = 58.2 bits (139), Expect = 3e-07 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 8/97 (8%) Frame = +2 Query: 134 GIRNRADCGVMSALNYKVPLED--------VGHNNKEIDNMILQYPERGSDRVDWMDREF 289 G+ +A+ + L Y+ L D HN + + NM + P+ F Sbjct: 19 GMITQAEFRIFQQLAYEDELSDDEDYVEHMFRHNRQGLCNMGEREPQT-----------F 67 Query: 290 RMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISEE 400 RMK++LP+FNGQL I+ FLDWL +E FFD M+I E+ Sbjct: 68 RMKMDLPSFNGQLQIEGFLDWLAVVERFFDYMEIPED 104 >KCW45836.1 hypothetical protein EUGRSUZ_L00350 [Eucalyptus grandis] Length = 380 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = +2 Query: 212 NKEIDNMILQYPERGSDRVDWMDRE---FRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDS 382 + E + L P G R R+ +++KV+LP FNG L+I+DFLDWL ++E FFD+ Sbjct: 291 DSEGEEEFLDQPVHGGHRNGGYQRDPEQYQLKVDLPIFNGNLNIEDFLDWLWKVEKFFDA 350 Query: 383 MDISEE 400 M+I E+ Sbjct: 351 MEIEED 356 >XP_011459809.1 PREDICTED: uncharacterized protein LOC105350104 [Fragaria vesca subsp. vesca] Length = 463 Score = 55.8 bits (133), Expect = 2e-06 Identities = 19/41 (46%), Positives = 36/41 (87%) Frame = +2 Query: 278 DREFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISEE 400 D++FRMKV++P FNG++++++FLDW IE++ F + M+++E+ Sbjct: 86 DKDFRMKVDIPFFNGKMNVEEFLDWQIEVDRFMEHMNVAEQ 126 >XP_007203374.1 hypothetical protein PRUPE_ppa025932mg [Prunus persica] ONH94794.1 hypothetical protein PRUPE_7G030900 [Prunus persica] Length = 286 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/42 (54%), Positives = 34/42 (80%) Frame = +2 Query: 272 WMDREFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 +MD +FR+K ++P FNG L I+DFLDWL+E+E FF+ M++ E Sbjct: 62 YMD-DFRIKADIPYFNGHLQIEDFLDWLVEVECFFEIMEVLE 102 >XP_007207970.1 hypothetical protein PRUPE_ppa016339mg, partial [Prunus persica] Length = 566 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 77 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 114 >XP_011457549.1 PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. vesca] Length = 930 Score = 54.7 bits (130), Expect = 5e-06 Identities = 19/40 (47%), Positives = 34/40 (85%) Frame = +2 Query: 278 DREFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 D++FRMKV++P FNG +++++FLDW IE++ F + M+++E Sbjct: 86 DKDFRMKVDIPFFNGMMNVEEFLDWQIEVDRFIEHMNVAE 125 >XP_016649787.1 PREDICTED: uncharacterized protein LOC103333039 [Prunus mume] Length = 1206 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 112 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 149 >XP_007220384.1 hypothetical protein PRUPE_ppa021778mg [Prunus persica] Length = 1384 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 105 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 142 >XP_007220740.1 hypothetical protein PRUPE_ppa023598mg [Prunus persica] Length = 1457 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 77 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 114 >XP_007210190.1 hypothetical protein PRUPE_ppa017790mg [Prunus persica] Length = 1485 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 101 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 138 >XP_007207232.1 hypothetical protein PRUPE_ppa026856mg [Prunus persica] Length = 1493 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 284 EFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 ++R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 112 DYRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 149 >XP_011465829.1 PREDICTED: uncharacterized protein LOC105351921 [Fragaria vesca subsp. vesca] Length = 656 Score = 53.9 bits (128), Expect = 9e-06 Identities = 21/67 (31%), Positives = 44/67 (65%) Frame = +2 Query: 200 VGHNNKEIDNMILQYPERGSDRVDWMDREFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFD 379 V + + ++ + + + G D D++FRMKV +P FNG +++++FLDW IE++ F + Sbjct: 65 VDSSESDSEDEAVDHEQLGQD-----DKDFRMKVGIPFFNGMMNVEEFLDWQIEVDRFME 119 Query: 380 SMDISEE 400 M+++++ Sbjct: 120 HMNVAKD 126 >XP_015867559.1 PREDICTED: uncharacterized protein LOC107405062 [Ziziphus jujuba] Length = 800 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = +2 Query: 239 QYPERGSDRV--DWMDREFRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISEE 400 +Y + G R D ++R+KV++PNF+G L+I+DFLDW+ +E FF+ M I E+ Sbjct: 84 RYAQAGPHRYARDHQPSDYRIKVDIPNFDGSLNIEDFLDWVQTVESFFEYMSIPED 139 >XP_007216161.1 hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] Length = 1150 Score = 53.9 bits (128), Expect = 9e-06 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +2 Query: 287 FRMKVNLPNFNGQLHIKDFLDWLIEIEHFFDSMDISE 397 +R+K +PNF G L I+DFLDWL+E+E FFD M++ E Sbjct: 111 YRIKAEIPNFWGNLKIEDFLDWLVEVERFFDIMEVPE 147