BLASTX nr result
ID: Magnolia22_contig00007614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007614 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006387832.1 hypothetical protein POPTR_0535s00220g, partial [... 58 2e-08 XP_006388324.1 hypothetical protein POPTR_0229s00250g [Populus t... 56 1e-06 XP_011015163.1 PREDICTED: uncharacterized protein LOC105118819 [... 55 4e-06 >XP_006387832.1 hypothetical protein POPTR_0535s00220g, partial [Populus trichocarpa] ERP46746.1 hypothetical protein POPTR_0535s00220g, partial [Populus trichocarpa] Length = 104 Score = 58.2 bits (139), Expect = 2e-08 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = +1 Query: 187 EDVGPNNKEIDNMILQHPERGSDRVDWMDREFRMKVNLPNFNGQLHIKDFLD*LIEIERF 366 ED+ ++E IL+ RG R + FRMK++LP+FNGQL IK LD L+ +ERF Sbjct: 9 EDILSEDEEEAEAILRGNRRGYQR-EPDQHMFRMKMDLPSFNGQLQIKGLLDWLVLVERF 67 Query: 367 FEYMDI 384 F+YMDI Sbjct: 68 FDYMDI 73 >XP_006388324.1 hypothetical protein POPTR_0229s00250g [Populus trichocarpa] ERP47238.1 hypothetical protein POPTR_0229s00250g [Populus trichocarpa] Length = 315 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = +1 Query: 232 QHPERGSDRVDWMDRE-FRMKVNLPNFNGQLHIKDFLD*LIEIERFFEYMDI 384 QH +G V + + FRMK++LPNFNGQL I+ FLD L +ERFF+YM+I Sbjct: 3 QHNRQGQRNVGEREPQTFRMKMDLPNFNGQLQIEGFLDWLAIVERFFDYMEI 54 >XP_011015163.1 PREDICTED: uncharacterized protein LOC105118819 [Populus euphratica] Length = 1026 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/86 (34%), Positives = 51/86 (59%) Frame = +1 Query: 127 GICNRADRGVMSALNYKVPLEDVGPNNKEIDNMILQHPERGSDRVDWMDREFRMKVNLPN 306 G+ +A+ + L Y+ L D + +++M + + + + + FRMK++LP+ Sbjct: 19 GMITQAEFRIFQQLAYEDELSD---DEDYVEHMFRHNRQGLCNMGEREPQTFRMKMDLPS 75 Query: 307 FNGQLHIKDFLD*LIEIERFFEYMDI 384 FNGQL I+ FLD L +ERFF+YM+I Sbjct: 76 FNGQLQIEGFLDWLAVVERFFDYMEI 101