BLASTX nr result
ID: Magnolia22_contig00006648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00006648 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN13096.1 hypothetical protein AMTR_s00040p00164100 [Amborella ... 50 8e-06 >ERN13096.1 hypothetical protein AMTR_s00040p00164100 [Amborella trichopoda] Length = 68 Score = 50.4 bits (119), Expect = 8e-06 Identities = 29/64 (45%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +3 Query: 30 MSKILSTTWQALETAPSRMITIDRRPTSEKRLETIHEER-VMPGYDGKSPGQETLMVDIG 206 M+K+L T Q +ETAP R+I +DRRP+ + RLETI EE DG S + T +D Sbjct: 1 MAKVLGATRQTMETAPPRIIKVDRRPSFDLRLETIQEETDGNSRKDGSSGLESTSKMDFK 60 Query: 207 KRVS 218 +R S Sbjct: 61 RRPS 64