BLASTX nr result
ID: Magnolia22_contig00006365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00006365 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012473273.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 66 4e-11 XP_016744959.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 65 8e-11 XP_004139989.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 65 1e-10 XP_008448128.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 65 1e-10 XP_017624684.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 65 2e-10 XP_016721832.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 65 2e-10 XP_016730027.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 64 2e-10 XP_017969513.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 64 3e-10 EOX93567.1 RING/U-box superfamily protein, putative [Theobroma c... 64 3e-10 JAT54601.1 RING-H2 zinc finger protein RHA1a [Anthurium amnicola... 64 4e-10 XP_012491469.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 64 4e-10 XP_011009089.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 64 5e-10 OAY35011.1 hypothetical protein MANES_12G064600 [Manihot esculenta] 64 5e-10 XP_002264718.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 63 6e-10 XP_002321207.1 hypothetical protein POPTR_0014s16830g [Populus t... 63 9e-10 XP_012485640.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 63 1e-09 XP_016742645.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 63 1e-09 XP_017603024.1 PREDICTED: probable E3 ubiquitin-protein ligase X... 63 1e-09 GAV68439.1 zf-RING_2 domain-containing protein [Cephalotus folli... 62 1e-09 OMO55110.1 Zinc finger, RING/FYVE/PHD-type [Corchorus capsularis] 62 1e-09 >XP_012473273.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] XP_012473282.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] KJB08727.1 hypothetical protein B456_001G099600 [Gossypium raimondii] KJB08728.1 hypothetical protein B456_001G099600 [Gossypium raimondii] KJB08729.1 hypothetical protein B456_001G099600 [Gossypium raimondii] Length = 150 Score = 66.2 bits (160), Expect = 4e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIHPAP 3 MG+SSLPSPSEGVL I+L+NTALSI+I+K I+RSI + +G+H P Sbjct: 1 MGLSSLPSPSEGVLCILLVNTALSISIVKGIIRSILHVVGVHLPP 45 >XP_016744959.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_016744960.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_016744961.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_016744962.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] Length = 150 Score = 65.5 bits (158), Expect = 8e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIHPAP 3 MG+SSLP+PSEGVL I+L+NTALSI+I+K I+RSI + +GIH P Sbjct: 1 MGLSSLPAPSEGVLCILLVNTALSISIVKGIIRSILHVVGIHLPP 45 >XP_004139989.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Cucumis sativus] KGN46618.1 hypothetical protein Csa_6G113550 [Cucumis sativus] Length = 155 Score = 65.1 bits (157), Expect = 1e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL +IL+NTALSI+I K IVRSI + +GIH Sbjct: 1 MGLSSLPAPSEGVLGVILVNTALSISIFKGIVRSILHVVGIH 42 >XP_008448128.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Cucumis melo] Length = 156 Score = 65.1 bits (157), Expect = 1e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL +IL+NTALSI+I K IVRSI + +GIH Sbjct: 1 MGLSSLPAPSEGVLGVILVNTALSISIFKGIVRSILHVVGIH 42 >XP_017624684.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium arboreum] Length = 150 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/46 (67%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH-PAP 3 MG+SSLP+PSEGVL I+L+NTALSI+I+K I+RSI + +GIH P P Sbjct: 1 MGLSSLPAPSEGVLCILLVNTALSISIVKGIIRSILHVVGIHLPQP 46 >XP_016721832.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] Length = 150 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/46 (67%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH-PAP 3 MG+SSLP+PSEGVL I+L+NTALSI+I+K I+RSI + +GIH P P Sbjct: 1 MGLSSLPAPSEGVLCILLVNTALSISIVKGIIRSILHVVGIHLPQP 46 >XP_016730027.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_016730028.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_017624847.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium arboreum] XP_017624852.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium arboreum] KHG07724.1 putative E3 ubiquitin-protein ligase RHA2B -like protein [Gossypium arboreum] Length = 149 Score = 64.3 bits (155), Expect = 2e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLPSPSEG+L IIL+NTALSI+++K I+RSI + +GIH Sbjct: 1 MGLSSLPSPSEGMLCIILVNTALSISVIKGILRSILHVVGIH 42 >XP_017969513.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Theobroma cacao] XP_017969514.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Theobroma cacao] Length = 151 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL I+L+NTALSI+I+K I+RSI + +GIH Sbjct: 1 MGLSSLPAPSEGVLCILLVNTALSISIVKGIIRSILHIVGIH 42 >EOX93567.1 RING/U-box superfamily protein, putative [Theobroma cacao] Length = 151 Score = 63.9 bits (154), Expect = 3e-10 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL I+L+NTALSI+I+K I+RSI + +GIH Sbjct: 1 MGLSSLPAPSEGVLCILLVNTALSISIVKGIIRSILHIVGIH 42 >JAT54601.1 RING-H2 zinc finger protein RHA1a [Anthurium amnicola] JAT67633.1 RING-H2 zinc finger protein RHA1a [Anthurium amnicola] Length = 142 Score = 63.5 bits (153), Expect = 4e-10 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIHPA 6 MGISSLP+PSEGVL+++L+NTALSI++ K IVRS+ + +G+H A Sbjct: 1 MGISSLPAPSEGVLTLLLVNTALSISLFKEIVRSLLHVVGLHRA 44 >XP_012491469.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] XP_012491477.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] XP_016746176.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] KJB10772.1 hypothetical protein B456_001G223700 [Gossypium raimondii] KJB10773.1 hypothetical protein B456_001G223700 [Gossypium raimondii] KJB10774.1 hypothetical protein B456_001G223700 [Gossypium raimondii] Length = 149 Score = 63.5 bits (153), Expect = 4e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLPSPSEG+L I+L+NTALSI+++K I+RSI + +GIH Sbjct: 1 MGLSSLPSPSEGMLCILLVNTALSISVIKGILRSILHVVGIH 42 >XP_011009089.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus euphratica] XP_011009090.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus euphratica] XP_011009091.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Populus euphratica] Length = 153 Score = 63.5 bits (153), Expect = 5e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIHPAP 3 MG+SSLP+PSEGVL +IL+NTALSI+I+K IVRSI + +GI +P Sbjct: 1 MGLSSLPAPSEGVLCVILVNTALSISIVKGIVRSILHIVGIRLSP 45 >OAY35011.1 hypothetical protein MANES_12G064600 [Manihot esculenta] Length = 160 Score = 63.5 bits (153), Expect = 5e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLPSPSEG+L ++L+NTALSI+I K IVRSI + +GIH Sbjct: 1 MGLSSLPSPSEGMLCVLLVNTALSISIFKGIVRSILHIVGIH 42 >XP_002264718.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Vitis vinifera] XP_010657496.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Vitis vinifera] Length = 151 Score = 63.2 bits (152), Expect = 6e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL ++L+NTALSI+I K IVR+I + IGIH Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISIFKGIVRAILHVIGIH 42 >XP_002321207.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] XP_006375582.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] XP_006375583.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] XP_006375584.1 putative RING zinc finger family protein [Populus trichocarpa] XP_006375585.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] EEE99522.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] ERP53379.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] ERP53380.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] ERP53381.1 putative RING zinc finger family protein [Populus trichocarpa] ERP53382.1 hypothetical protein POPTR_0014s16830g [Populus trichocarpa] Length = 153 Score = 62.8 bits (151), Expect = 9e-10 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIHPAP 3 MG+SSLP+PSEGVL ++L+NTALSI+I+K IVRSI + +GI +P Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISIVKGIVRSILHIVGIRLSP 45 >XP_012485640.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] XP_012485647.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium raimondii] XP_016745822.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] XP_016745823.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] KJB06279.1 hypothetical protein B456_001G190300 [Gossypium raimondii] KJB06280.1 hypothetical protein B456_001G190300 [Gossypium raimondii] Length = 162 Score = 62.8 bits (151), Expect = 1e-09 Identities = 27/42 (64%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL ++L+NTALSI+++K I+RSI + +GIH Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISMVKGIIRSILHVVGIH 42 >XP_016742645.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium hirsutum] Length = 166 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL ++L+NTALSI+++K I+RSI + IGIH Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISMVKGIIRSILHIIGIH 42 >XP_017603024.1 PREDICTED: probable E3 ubiquitin-protein ligase XERICO [Gossypium arboreum] Length = 167 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL ++L+NTALSI+++K I+RSI + IGIH Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISMVKGIIRSILHIIGIH 42 >GAV68439.1 zf-RING_2 domain-containing protein [Cephalotus follicularis] Length = 157 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/41 (65%), Positives = 38/41 (92%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGI 15 MG+SSLP+PSEGVL ++L+NTALSI+I+K++VRSI N +G+ Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISIVKAVVRSILNIVGV 41 >OMO55110.1 Zinc finger, RING/FYVE/PHD-type [Corchorus capsularis] Length = 142 Score = 62.0 bits (149), Expect = 1e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 137 MGISSLPSPSEGVLSIILINTALSITILKSIVRSIFNAIGIH 12 MG+SSLP+PSEGVL ++L+NTALSI+I+K I RSI +GIH Sbjct: 1 MGLSSLPAPSEGVLCVLLVNTALSISIVKGIFRSILQVVGIH 42