BLASTX nr result
ID: Magnolia22_contig00006235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00006235 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KMT16937.1 hypothetical protein BVRB_2g044070 [Beta vulgaris sub... 50 2e-06 >KMT16937.1 hypothetical protein BVRB_2g044070 [Beta vulgaris subsp. vulgaris] Length = 34 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = +3 Query: 18 MALRIVYALVFLSVSCACFKLLYFVLHPIFHLTT 119 M LR +Y L+FLS+SC F LYF LHP+F+LT+ Sbjct: 1 MGLRFLYGLLFLSISCVAFTFLYFALHPVFYLTS 34