BLASTX nr result
ID: Magnolia22_contig00004123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00004123 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012738485.1 autophagy-like protein 8 [Pseudogymnoascus destru... 86 1e-19 XP_019024348.1 microtubule-associated protein [Saitoella complic... 85 3e-19 XP_002836051.1 hypothetical protein [Tuber melanosporum Mel28] C... 86 4e-19 KKY28847.1 putative autophagy protein 8 [Phaeomoniella chlamydos... 85 4e-19 KFX89099.1 hypothetical protein O988_08760 [Pseudogymnoascus sp.... 84 9e-19 KZV94091.1 light chain 3 [Exidia glandulosa HHB12029] 83 2e-18 XP_011118737.1 hypothetical protein AOL_s00007g534 [Arthrobotrys... 82 4e-18 KDB12146.1 microtubule-associated protein [Ustilaginoidea virens... 81 1e-17 CRG83213.1 Autophagy-related protein 8 [Talaromyces islandicus] 80 3e-17 GAD97317.1 autophagic death protein Aut7/IDI-7, putative [Byssoc... 80 3e-17 XP_011113047.1 hypothetical protein H072_7285 [Dactylellina hapt... 80 3e-17 XP_007914855.1 putative autophagic death protein aut7 idi- prote... 80 3e-17 XP_007338944.1 light chain 3 [Auricularia subglabra TFB-10046 SS... 80 3e-17 CEJ94485.1 Putative Autophagy-related protein [Torrubiella hemip... 80 4e-17 GAO46358.1 hypothetical protein G7K_0590-t1 [Saitoella complicat... 85 4e-17 EUC54649.1 autophagy protein Atg8 ubiquitin-like protein [Rhizoc... 80 4e-17 XP_003233511.1 autophagy protein 8 [Trichophyton rubrum CBS 1188... 80 4e-17 CCF31883.1 microtubule associated protein 1A/1B, partial [Collet... 79 4e-17 XP_016209840.1 hypothetical protein PV09_08481 [Verruconis gallo... 79 5e-17 GAM83596.1 hypothetical protein ANO11243_015840 [fungal sp. No.1... 79 5e-17 >XP_012738485.1 autophagy-like protein 8 [Pseudogymnoascus destructans 20631-21] XP_018135234.1 autophagy-like protein 8 [Pseudogymnoascus verrucosus] ELR01721.1 autophagy-like protein 8 [Pseudogymnoascus destructans 20631-21] KFY09325.1 hypothetical protein V492_05527 [Pseudogymnoascus sp. VKM F-4246] KFY33878.1 hypothetical protein V494_07242 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] KFY71569.1 hypothetical protein V499_08229 [Pseudogymnoascus sp. VKM F-103] KFY85203.1 hypothetical protein V500_08623 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ09163.1 hypothetical protein V502_08894 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] KFZ20473.1 hypothetical protein V501_00113 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] OAF62232.1 autophagy-like protein 8 [Pseudogymnoascus destructans] OBT47845.1 autophagy-like protein 8 [Pseudogymnoascus sp. WSF 3629] OBT59568.1 autophagy-like protein 8 [Pseudogymnoascus sp. 24MN13] OBT67965.1 autophagy-like protein 8 [Pseudogymnoascus sp. 23342-1-I1] OBT79183.1 autophagy-like protein 8 [Pseudogymnoascus sp. 05NY08] OBT90948.1 autophagy-like protein 8 [Pseudogymnoascus sp. 03VT05] OBU01502.1 autophagy-like protein 8 [Pseudogymnoascus verrucosus] Length = 121 Score = 86.3 bits (212), Expect = 1e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFGFEEL Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEEL 120 >XP_019024348.1 microtubule-associated protein [Saitoella complicata NRRL Y-17804] ODQ53235.1 microtubule-associated protein [Saitoella complicata NRRL Y-17804] Length = 120 Score = 85.1 bits (209), Expect = 3e-19 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMS+IY+EHKDEDGFLYITYSGENTFGFEEL Sbjct: 80 VDEVLPPTAALMSAIYEEHKDEDGFLYITYSGENTFGFEEL 120 >XP_002836051.1 hypothetical protein [Tuber melanosporum Mel28] CAZ80208.1 unnamed protein product [Tuber melanosporum] Length = 173 Score = 86.3 bits (212), Expect = 4e-19 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFGFEEL Sbjct: 132 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEEL 172 >KKY28847.1 putative autophagy protein 8 [Phaeomoniella chlamydospora] Length = 120 Score = 84.7 bits (208), Expect = 4e-19 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEE 191 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFGFEE Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGFEE 119 >KFX89099.1 hypothetical protein O988_08760 [Pseudogymnoascus sp. VKM F-3808] KFX89273.1 hypothetical protein V490_07131 [Pseudogymnoascus sp. VKM F-3557] KFY14542.1 hypothetical protein V491_06006 [Pseudogymnoascus sp. VKM F-3775] KFY27392.1 hypothetical protein V493_03515 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] KFY37086.1 hypothetical protein V495_07389 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY55637.1 hypothetical protein V497_06806 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY67627.1 hypothetical protein V496_01518 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY88983.1 hypothetical protein V498_06571 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 121 Score = 84.0 bits (206), Expect = 9e-19 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG EEL Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGLEEL 120 >KZV94091.1 light chain 3 [Exidia glandulosa HHB12029] Length = 120 Score = 82.8 bits (203), Expect = 2e-18 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMS+IY+EHKDEDGFLY+TYSGENTFG+EEL Sbjct: 80 VDEVLPPTAALMSAIYEEHKDEDGFLYVTYSGENTFGWEEL 120 >XP_011118737.1 hypothetical protein AOL_s00007g534 [Arthrobotrys oligospora ATCC 24927] EGX52603.1 hypothetical protein AOL_s00007g534 [Arthrobotrys oligospora ATCC 24927] Length = 122 Score = 82.4 bits (202), Expect = 4e-18 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG+E L Sbjct: 81 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGYEYL 121 >KDB12146.1 microtubule-associated protein [Ustilaginoidea virens] GAO15026.1 hypothetical protein UVI_02027520 [Ustilaginoidea virens] Length = 121 Score = 80.9 bits (198), Expect = 1e-17 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGF 197 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFGF Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGF 117 >CRG83213.1 Autophagy-related protein 8 [Talaromyces islandicus] Length = 118 Score = 80.1 bits (196), Expect = 3e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG 200 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG Sbjct: 80 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG 116 >GAD97317.1 autophagic death protein Aut7/IDI-7, putative [Byssochlamys spectabilis No. 5] Length = 118 Score = 80.1 bits (196), Expect = 3e-17 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG 200 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG Sbjct: 80 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG 116 >XP_011113047.1 hypothetical protein H072_7285 [Dactylellina haptotyla CBS 200.50] EPS38971.1 hypothetical protein H072_7285 [Dactylellina haptotyla CBS 200.50] Length = 122 Score = 80.1 bits (196), Expect = 3e-17 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG E L Sbjct: 81 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDEYL 121 >XP_007914855.1 putative autophagic death protein aut7 idi- protein [Phaeoacremonium minimum UCRPA7] EOO00431.1 putative autophagic death protein aut7 idi- protein [Phaeoacremonium minimum UCRPA7] Length = 122 Score = 80.1 bits (196), Expect = 3e-17 Identities = 39/41 (95%), Positives = 40/41 (97%), Gaps = 1/41 (2%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG-FEE 191 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG FEE Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDFEE 120 >XP_007338944.1 light chain 3 [Auricularia subglabra TFB-10046 SS5] EJD53368.1 light chain 3 [Auricularia subglabra TFB-10046 SS5] Length = 122 Score = 80.1 bits (196), Expect = 3e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEE 191 VDEVLPPTAALMS+IY+EHKDEDGFLY+TYSGENTFG EE Sbjct: 80 VDEVLPPTAALMSAIYEEHKDEDGFLYVTYSGENTFGCEE 119 >CEJ94485.1 Putative Autophagy-related protein [Torrubiella hemipterigena] Length = 118 Score = 79.7 bits (195), Expect = 4e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFE 194 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG E Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSE 118 >GAO46358.1 hypothetical protein G7K_0590-t1 [Saitoella complicata NRRL Y-17804] Length = 885 Score = 85.1 bits (209), Expect = 4e-17 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFEEL 188 VDEVLPPTAALMS+IY+EHKDEDGFLYITYSGENTFGFEEL Sbjct: 845 VDEVLPPTAALMSAIYEEHKDEDGFLYITYSGENTFGFEEL 885 >EUC54649.1 autophagy protein Atg8 ubiquitin-like protein [Rhizoctonia solani AG-3 Rhs1AP] KEP51152.1 autophagy protein Atg8 ubiquitin-like protein [Rhizoctonia solani 123E] Length = 119 Score = 79.7 bits (195), Expect = 4e-17 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFE 194 VDEVLPPTAALMS+IY+EHKDEDGFLY++YSGENTFGFE Sbjct: 80 VDEVLPPTAALMSAIYEEHKDEDGFLYVSYSGENTFGFE 118 >XP_003233511.1 autophagy protein 8 [Trichophyton rubrum CBS 118892] EGD90270.1 hypothetical protein TERG_06497 [Trichophyton rubrum CBS 118892] EZF24778.1 hypothetical protein H100_02749 [Trichophyton rubrum MR850] EZF43830.1 hypothetical protein H102_02742 [Trichophyton rubrum CBS 100081] EZF54471.1 hypothetical protein H103_02753 [Trichophyton rubrum CBS 288.86] EZF65144.1 hypothetical protein H104_02732 [Trichophyton rubrum CBS 289.86] EZF75811.1 hypothetical protein H105_02759 [Trichophyton soudanense CBS 452.61] EZF86407.1 hypothetical protein H110_02751 [Trichophyton rubrum MR1448] EZF97232.1 hypothetical protein H113_02754 [Trichophyton rubrum MR1459] EZG09365.1 hypothetical protein H106_01573 [Trichophyton rubrum CBS 735.88] EZG18724.1 hypothetical protein H107_02828 [Trichophyton rubrum CBS 202.88] KDB35586.1 hypothetical protein H112_02743 [Trichophyton rubrum D6] KMQ41483.1 hypothetical protein HL42_7830 [Trichophyton rubrum] OAL67992.1 hypothetical protein A7C99_1125 [Trichophyton rubrum] OAL74040.1 autophagy protein 8 [Trichophyton violaceum] Length = 122 Score = 79.7 bits (195), Expect = 4e-17 Identities = 39/42 (92%), Positives = 40/42 (95%), Gaps = 1/42 (2%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG-FEEL 188 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG F EL Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGSFSEL 121 >CCF31883.1 microtubule associated protein 1A/1B, partial [Colletotrichum higginsianum] Length = 86 Score = 78.6 bits (192), Expect = 4e-17 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFG 200 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG Sbjct: 45 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFG 81 >XP_016209840.1 hypothetical protein PV09_08481 [Verruconis gallopava] KIV99970.1 hypothetical protein PV09_08481 [Verruconis gallopava] Length = 119 Score = 79.3 bits (194), Expect = 5e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFE 194 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG E Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDE 118 >GAM83596.1 hypothetical protein ANO11243_015840 [fungal sp. No.11243] Length = 119 Score = 79.3 bits (194), Expect = 5e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 310 VDEVLPPTAALMSSIYDEHKDEDGFLYITYSGENTFGFE 194 VDEVLPPTAALMSSIY+EHKDEDGFLYITYSGENTFG E Sbjct: 80 VDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEE 118