BLASTX nr result
ID: Magnolia22_contig00003869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00003869 (410 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAH57240.1 AT4G35750 [Arabidopsis thaliana] 51 5e-06 >BAH57240.1 AT4G35750 [Arabidopsis thaliana] Length = 67 Score = 50.8 bits (120), Expect = 5e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 410 LERLQPFKIQGRDKGGRKILRIVGKFFPG--INQHPHLFSLPLLIFL 276 +E+L+ FKI GRDK GRKILRI+GKFFPG I+ FSL + +FL Sbjct: 14 IEKLEIFKIHGRDKRGRKILRIIGKFFPGTDISIGSVSFSLCVDLFL 60