BLASTX nr result
ID: Magnolia22_contig00003777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00003777 (774 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010264734.1 PREDICTED: protein transport protein Sec61 subuni... 90 3e-19 ABK25751.1 unknown [Picea sitchensis] ABK26018.1 unknown [Picea ... 89 6e-19 KHN05729.1 Protein transport protein Sec61 subunit beta [Glycine... 87 2e-18 XP_010253613.1 PREDICTED: protein transport protein Sec61 subuni... 87 2e-18 XP_003538051.1 PREDICTED: protein transport protein Sec61 subuni... 87 2e-18 XP_019459014.1 PREDICTED: protein transport protein Sec61 subuni... 87 2e-18 XP_004487131.1 PREDICTED: protein transport protein Sec61 subuni... 87 3e-18 XP_009399991.1 PREDICTED: protein transport protein Sec61 subuni... 87 3e-18 GAU15623.1 hypothetical protein TSUD_108820 [Trifolium subterran... 87 3e-18 XP_002276029.1 PREDICTED: protein transport protein Sec61 subuni... 87 3e-18 XP_010651144.1 PREDICTED: protein transport protein Sec61 subuni... 87 4e-18 XP_017245008.1 PREDICTED: protein transport protein Sec61 subuni... 86 6e-18 XP_017432826.1 PREDICTED: protein transport protein Sec61 subuni... 86 6e-18 ABG24204.1 putative transport protein [Gymnadenia conopsea] 86 6e-18 XP_009367786.1 PREDICTED: protein transport protein Sec61 subuni... 85 7e-18 XP_007132194.1 hypothetical protein PHAVU_011G073900g [Phaseolus... 86 8e-18 XP_009343174.1 PREDICTED: protein transport protein Sec61 subuni... 85 1e-17 XP_014498123.1 PREDICTED: protein transport protein Sec61 subuni... 85 1e-17 XP_017424405.1 PREDICTED: protein transport protein Sec61 subuni... 85 1e-17 XP_007150218.1 hypothetical protein PHAVU_005G136600g [Phaseolus... 85 2e-17 >XP_010264734.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Nelumbo nucifera] Length = 107 Score = 89.7 bits (221), Expect = 3e-19 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG Sbjct: 64 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 105 >ABK25751.1 unknown [Picea sitchensis] ABK26018.1 unknown [Picea sitchensis] ACN40938.1 unknown [Picea sitchensis] Length = 108 Score = 89.0 bits (219), Expect = 6e-19 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKITPTVVLVMSLCFIGFVTALHV GKLYRYRSGGA Sbjct: 66 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVIGKLYRYRSGGA 108 >KHN05729.1 Protein transport protein Sec61 subunit beta [Glycine soja] Length = 99 Score = 87.4 bits (215), Expect = 2e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRYRS GA Sbjct: 55 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYRSSGA 97 >XP_010253613.1 PREDICTED: protein transport protein Sec61 subunit beta [Nelumbo nucifera] Length = 107 Score = 87.4 bits (215), Expect = 2e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSG 254 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSG Sbjct: 64 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSG 104 >XP_003538051.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] XP_006591027.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] XP_014620036.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Glycine max] KRH24907.1 hypothetical protein GLYMA_12G070500 [Glycine max] Length = 107 Score = 87.4 bits (215), Expect = 2e-18 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRYRS GA Sbjct: 63 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYRSSGA 105 >XP_019459014.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Lupinus angustifolius] OIW03936.1 hypothetical protein TanjilG_30212 [Lupinus angustifolius] Length = 108 Score = 87.4 bits (215), Expect = 2e-18 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRY+SGG+ Sbjct: 65 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYKSGGS 107 >XP_004487131.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Cicer arietinum] Length = 105 Score = 87.0 bits (214), Expect = 3e-18 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRY+SGG Sbjct: 62 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYKSGG 103 >XP_009399991.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Musa acuminata subsp. malaccensis] Length = 106 Score = 87.0 bits (214), Expect = 3e-18 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLK+TPTVVLVMSLCFIGFVTALHVFGKLYR+R+GGA Sbjct: 64 YTDDAPGLKMTPTVVLVMSLCFIGFVTALHVFGKLYRHRAGGA 106 >GAU15623.1 hypothetical protein TSUD_108820 [Trifolium subterraneum] Length = 107 Score = 87.0 bits (214), Expect = 3e-18 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRY+SGG Sbjct: 64 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYKSGG 105 >XP_002276029.1 PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] CAN75561.1 hypothetical protein VITISV_032577 [Vitis vinifera] Length = 108 Score = 87.0 bits (214), Expect = 3e-18 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGK+YR+RSGG Sbjct: 65 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKIYRHRSGG 106 >XP_010651144.1 PREDICTED: protein transport protein Sec61 subunit beta [Vitis vinifera] Length = 107 Score = 86.7 bits (213), Expect = 4e-18 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGK+YRY++GG Sbjct: 64 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKIYRYKAGG 105 >XP_017245008.1 PREDICTED: protein transport protein Sec61 subunit beta [Daucus carota subsp. sativus] KZM97089.1 hypothetical protein DCAR_015549 [Daucus carota subsp. sativus] Length = 106 Score = 86.3 bits (212), Expect = 6e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSG 254 YTDDAPGLKITPTVVLVMS+CFIGFVTALHVFGKLYRYRSG Sbjct: 63 YTDDAPGLKITPTVVLVMSVCFIGFVTALHVFGKLYRYRSG 103 >XP_017432826.1 PREDICTED: protein transport protein Sec61 subunit beta [Vigna angularis] BAT90610.1 hypothetical protein VIGAN_06187900 [Vigna angularis var. angularis] Length = 106 Score = 86.3 bits (212), Expect = 6e-18 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMS+CFIGFVTALHVFGKLYRYRSG A Sbjct: 63 YTDDAPGLKISPTVVLVMSVCFIGFVTALHVFGKLYRYRSGAA 105 >ABG24204.1 putative transport protein [Gymnadenia conopsea] Length = 107 Score = 86.3 bits (212), Expect = 6e-18 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLK++PTVVLVMSLCFIGFVTALHVFGKLYRY+SGG+ Sbjct: 65 YTDDAPGLKMSPTVVLVMSLCFIGFVTALHVFGKLYRYKSGGS 107 >XP_009367786.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Pyrus x bretschneideri] Length = 75 Score = 85.1 bits (209), Expect = 7e-18 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLY +RSGG Sbjct: 32 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYLHRSGG 73 >XP_007132194.1 hypothetical protein PHAVU_011G073900g [Phaseolus vulgaris] XP_007155103.1 hypothetical protein PHAVU_003G173500g [Phaseolus vulgaris] ESW04188.1 hypothetical protein PHAVU_011G073900g [Phaseolus vulgaris] ESW27097.1 hypothetical protein PHAVU_003G173500g [Phaseolus vulgaris] Length = 106 Score = 85.9 bits (211), Expect = 8e-18 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSG 254 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYRYRSG Sbjct: 63 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRYRSG 103 >XP_009343174.1 PREDICTED: protein transport protein Sec61 subunit beta-like, partial [Pyrus x bretschneideri] Length = 101 Score = 85.1 bits (209), Expect = 1e-17 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGG 251 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLY +RSGG Sbjct: 58 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYLHRSGG 99 >XP_014498123.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Vigna radiata var. radiata] Length = 103 Score = 85.1 bits (209), Expect = 1e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYR +SGGA Sbjct: 61 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGGA 103 >XP_017424405.1 PREDICTED: protein transport protein Sec61 subunit beta-like [Vigna angularis] KOM44207.1 hypothetical protein LR48_Vigan05g181200 [Vigna angularis] BAT91948.1 hypothetical protein VIGAN_07059400 [Vigna angularis var. angularis] Length = 103 Score = 85.1 bits (209), Expect = 1e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYR +SGGA Sbjct: 61 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGGA 103 >XP_007150218.1 hypothetical protein PHAVU_005G136600g [Phaseolus vulgaris] ESW22212.1 hypothetical protein PHAVU_005G136600g [Phaseolus vulgaris] Length = 105 Score = 85.1 bits (209), Expect = 2e-17 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -3 Query: 376 YTDDAPGLKITPTVVLVMSLCFIGFVTALHVFGKLYRYRSGGA 248 YTDDAPGLKI+PTVVLVMSLCFIGFVTALHVFGKLYR +SGGA Sbjct: 62 YTDDAPGLKISPTVVLVMSLCFIGFVTALHVFGKLYRSKSGGA 104