BLASTX nr result
ID: Magnolia22_contig00002954
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002954 (566 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001327982.1 rRNA-processing protein [Arabidopsis thaliana] AN... 54 7e-06 >NP_001327982.1 rRNA-processing protein [Arabidopsis thaliana] ANM66056.1 rRNA-processing protein [Arabidopsis thaliana] Length = 140 Score = 53.5 bits (127), Expect = 7e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -3 Query: 519 GKMFKRTQHGQPIMKYRIEHLLESIRRGAN*NAV 418 GKM ++T+HGQP+MKYRIEHLLESI++ A N + Sbjct: 106 GKMLRKTRHGQPVMKYRIEHLLESIKKSAGINEI 139