BLASTX nr result
ID: Magnolia22_contig00002863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002863 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV77438.1 hypothetical protein CFOL_v3_20909 [Cephalotus follic... 57 7e-07 >GAV77438.1 hypothetical protein CFOL_v3_20909 [Cephalotus follicularis] Length = 177 Score = 57.4 bits (137), Expect = 7e-07 Identities = 31/84 (36%), Positives = 41/84 (48%) Frame = +1 Query: 43 WMQIWLPHVHHSRRWNLNLLRMAWMNRRWWCRWAMMEGRRWWSWRTLLVNGRWSWRTLMV 222 W + W + RW LL + W NRRW +W ++E RWW W LV W W+ +V Sbjct: 99 WKRWWKWLLEKRNRWWKWLL-INW-NRRW--KWFLVEWNRWWKW--FLVEWNWWWKWFLV 152 Query: 223 RGRWGRRDLLVSRRWDRRALLVRW 294 W + LLV W R+ LV W Sbjct: 153 DWNWWWKWLLVDWNWWRKRFLVEW 176