BLASTX nr result
ID: Magnolia22_contig00002600
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002600 (437 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP81438.1 histone H3, partial [Diplodia seriata] 196 2e-62 XP_001539096.1 histone H3 [Histoplasma capsulatum NAm1] XP_00279... 196 3e-62 XP_002838909.1 hypothetical protein [Tuber melanosporum Mel28] C... 196 3e-62 XP_010756527.1 histone H3 [Paracoccidioides brasiliensis Pb18] E... 196 3e-62 XP_752749.1 histone H3 [Aspergillus fumigatus Af293] XP_00121067... 196 3e-62 CCX13616.1 Similar to Histone H3; acc. no. P23753 [Pyronema omph... 196 3e-62 XP_016761057.1 histone cluster 1, H3g [Sphaerulina musiva SO2202... 196 3e-62 XP_007582609.1 putative histone h3 protein [Neofusicoccum parvum... 196 3e-62 AFK38410.1 unknown [Medicago truncatula] 196 3e-62 NP_001106556.1 histone cluster 1, H3g protein [Xenopus tropicali... 196 3e-62 XP_001243947.1 histone H3 [Coccidioides immitis RS] XP_002582441... 196 3e-62 OJD26858.1 histone H3 [Blastomyces sp. CAC-2015b] 196 3e-62 KLJ09374.1 histone H3 [Emmonsia parva UAMH 139] 196 3e-62 XP_002626825.1 histone H3 [Blastomyces gilchristii SLH14081] EEQ... 196 3e-62 XP_001727504.2 histone H3 [Aspergillus oryzae RIB40] 196 3e-62 XP_658337.1 H3_EMENI Histone H3 [Aspergillus nidulans FGSC A4] E... 196 3e-62 XP_011110360.1 hypothetical protein H072_4460 [Dactylellina hapt... 195 8e-62 XP_017995755.1 histone H3 [Phialophora attae] KPI35792.1 histone... 196 9e-62 XP_001548662.1 histone H3 [Botrytis cinerea B05.10] XP_001589886... 194 1e-61 KZZ93205.1 histone H3 [Ascosphaera apis ARSEF 7405] 194 2e-61 >OMP81438.1 histone H3, partial [Diplodia seriata] Length = 128 Score = 196 bits (498), Expect = 2e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 28 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 87 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 88 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 128 >XP_001539096.1 histone H3 [Histoplasma capsulatum NAm1] XP_002790863.1 histone H3.3 [Paracoccidioides lutzii Pb01] EDN09534.1 histone H3 [Histoplasma capsulatum NAm1] EEH08601.1 histone H3 [Histoplasma capsulatum G186AR] EEH36681.1 histone H3.3 [Paracoccidioides lutzii Pb01] KKZ62812.1 histone H3 [Emmonsia crescens UAMH 3008] OAX78562.1 histone H3 [Emmonsia sp. CAC-2015a] OJD16644.1 histone H3 [Emmonsia pasteuriana UAMH 9510] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_002838909.1 hypothetical protein [Tuber melanosporum Mel28] CAZ83100.1 unnamed protein product [Tuber melanosporum] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_010756527.1 histone H3 [Paracoccidioides brasiliensis Pb18] EEH20185.1 histone H3 [Paracoccidioides brasiliensis Pb03] EEH44584.1 histone H3 [Paracoccidioides brasiliensis Pb18] ODH13328.1 histone H3 [Paracoccidioides brasiliensis] ODH47850.1 histone H3 [Paracoccidioides brasiliensis] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_752749.1 histone H3 [Aspergillus fumigatus Af293] XP_001210672.1 histone H3 [Aspergillus terreus NIH2624] XP_001264380.1 histone H3 [Aspergillus fischeri NRRL 181] XP_001268877.1 histone H3 [Aspergillus clavatus NRRL 1] XP_001392811.1 histone H3 [Aspergillus niger CBS 513.88] XP_002146151.1 histone H3 [Talaromyces marneffei ATCC 18224] XP_002375781.1 histone H3 [Aspergillus flavus NRRL3357] XP_002478436.1 histone H3 [Talaromyces stipitatus ATCC 10500] XP_002561526.1 Pc16g12270 [Penicillium rubens Wisconsin 54-1255] XP_013326956.1 histone H3 [Rasamsonia emersonii CBS 393.64] XP_014530887.1 Histone H3 [Penicillium digitatum Pd1] XP_015410579.1 histone H3 [Aspergillus nomius NRRL 13137] XP_016602796.1 Histone-fold [Penicillium expansum] XP_020061054.1 hypothetical protein ASPACDRAFT_1892954 [Aspergillus aculeatus ATCC 16872] XP_020124428.1 histone H3 [Talaromyces atroroseus] P23753.2 RecName: Full=Histone H3 P61832.2 RecName: Full=Histone H3 P61834.2 RecName: Full=Histone H3 Q2UCQ0.3 RecName: Full=Histone H3 Q0D0E8.1 RecName: Full=Histone H3 A1CP80.1 RecName: Full=Histone H3 A2QRR5.1 RecName: Full=Histone H3 A1D240.1 RecName: Full=Histone H3 CAA39154.1 H3 [Aspergillus nidulans] CAD29612.1 histone h3, putative [Aspergillus fumigatus] CAC85655.1 histone H3 [Talaromyces funiculosus] EAL90711.1 histone H3 [Aspergillus fumigatus Af293] BAE60665.1 unnamed protein product [Aspergillus oryzae RIB40] EAU39232.1 histone H3 [Aspergillus terreus NIH2624] EAW07451.1 histone H3 [Aspergillus clavatus NRRL 1] EAW22483.1 histone H3 [Aspergillus fischeri NRRL 181] CAK45666.1 unnamed protein product [Aspergillus niger] EDP56616.1 histone H3 [Aspergillus fumigatus A1163] EEA25604.1 histone H3 [Talaromyces marneffei ATCC 18224] CAP93897.1 Pc16g12270 [Penicillium rubens Wisconsin 54-1255] EED21473.1 histone H3 [Talaromyces stipitatus ATCC 10500] EED54509.1 histone H3 [Aspergillus flavus NRRL3357] CBF88887.1 TPA: Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P23753] [Aspergillus nidulans FGSC A4] EHA18232.1 H3 histone 3 protein [Aspergillus niger ATCC 1015] GAA87465.1 histone H3 [Aspergillus kawachii IFO 4308] EIT78939.1 histones H3 and H4 [Aspergillus oryzae 3.042] EKV08578.1 Histone H3 [Penicillium digitatum Pd1] EKV10088.1 Histone H3 [Penicillium digitatum PHI26] EPS25300.1 hypothetical protein PDE_00233 [Penicillium oxalicum 114-2] GAD98063.1 histone H3 [Byssochlamys spectabilis No. 5] CDM34834.1 Probable transposable element [Penicillium roqueforti FM164] EYE99137.1 H3 histone 3 protein [Aspergillus ruber CBS 135680] KDE80118.1 histones H3 and H4 [Aspergillus oryzae 100-8] KEY76780.1 histone H3 [Aspergillus fumigatus var. RP-2014] KFX44895.1 histone H3 [Talaromyces marneffei PM1] KGO38937.1 Histone-fold [Penicillium expansum] KGO58012.1 Histone-fold [Penicillium expansum] KGO62177.1 Histone-fold [Penicillium expansum] KGO76760.1 Histone-fold [Penicillium italicum] GAM42843.1 histone [Talaromyces cellulolyticus] KKA20344.1 histone H3 [Rasamsonia emersonii CBS 393.64] CRG89558.1 Histone H3 [Talaromyces islandicus] KKK23520.1 histone H3 [Aspergillus ochraceoroseus] KKK26676.1 histone H3 [Aspergillus rambellii] KMK62604.1 histone H3 [Aspergillus fumigatus Z5] GAO89091.1 histone H3 [Aspergillus udagawae] CEO59349.1 Putative Histone H3 [Penicillium brasilianum] CRL24975.1 Histone H3 [Penicillium camemberti] KNG89656.1 histone H3 [Aspergillus nomius NRRL 13137] KOC11757.1 histone H3 [Aspergillus flavus AF70] KOS41798.1 hypothetical protein ACN38_g7345 [Penicillium nordicum] GAQ10570.1 histone H3 [Aspergillus lentulus] GAQ41883.1 histone H3 [Aspergillus niger] CEL09549.1 Putative Histone H3 [Aspergillus calidoustus] KUL88606.1 hypothetical protein ZTR_05226 [Talaromyces verruculosus] KUM61810.1 hypothetical protein ACN42_g5284 [Penicillium freii] KXG50710.1 Histone-fold [Penicillium griseofulvum] GAT28625.1 histone H3 [Aspergillus luchuensis] KZN93543.1 histone H3 [Penicillium chrysogenum] ODM18669.1 histone H3 [Aspergillus cristatus] OGE54986.1 hypothetical protein PENARI_c005G00376 [Penicillium arizonense] OGM48594.1 histone H3 [Aspergillus bombycis] OJI91116.1 hypothetical protein ASPTUDRAFT_186892 [Aspergillus tubingensis CBS 134.48] OJI96871.1 hypothetical protein ASPVEDRAFT_48967 [Aspergillus versicolor CBS 583.65] OJJ35102.1 hypothetical protein ASPWEDRAFT_40251 [Aspergillus wentii DTO 134E9] OJJ50006.1 hypothetical protein ASPZODRAFT_57830 [Penicilliopsis zonata CBS 506.65] OJJ62826.1 hypothetical protein ASPSYDRAFT_143421 [Aspergillus sydowii CBS 593.65] OJJ73516.1 hypothetical protein ASPBRDRAFT_53699 [Aspergillus brasiliensis CBS 101740] OJJ87543.1 hypothetical protein ASPGLDRAFT_141916 [Aspergillus glaucus CBS 516.65] OJK04715.1 hypothetical protein ASPACDRAFT_1892954 [Aspergillus aculeatus ATCC 16872] OJZ88531.1 hypothetical protein ASPFODRAFT_44222 [Aspergillus luchuensis CBS 106.47] OKL64307.1 histone H3 [Talaromyces atroroseus] OKP06407.1 histone H3 [Penicillium subrubescens] OOG00706.1 hypothetical protein ASPCADRAFT_202541 [Aspergillus carbonarius ITEM 5010] prf||1707275B histone H3 Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >CCX13616.1 Similar to Histone H3; acc. no. P23753 [Pyronema omphalodes CBS 100304] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_016761057.1 histone cluster 1, H3g [Sphaerulina musiva SO2202] EMF12936.1 histone cluster 1, H3g [Sphaerulina musiva SO2202] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_007582609.1 putative histone h3 protein [Neofusicoccum parvum UCRNP2] XP_020133270.1 histone 3 [Diplodia corticola] EKG17672.1 hypothetical protein MPH_05121 [Macrophomina phaseolina MS6] EOD49888.1 putative histone h3 protein [Neofusicoccum parvum UCRNP2] KKY13236.1 putative histone H3 [Diplodia seriata] OJD37029.1 histone 3 [Diplodia corticola] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >AFK38410.1 unknown [Medicago truncatula] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >NP_001106556.1 histone cluster 1, H3g protein [Xenopus tropicalis] XP_003851442.1 histone H3 [Zymoseptoria tritici IPO323] XP_007295303.1 histone cluster 1, H3g [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] XP_007676780.1 hypothetical protein BAUCODRAFT_34428 [Baudoinia panamericana UAMH 10762] XP_007723998.1 histone H3 [Capronia coronata CBS 617.96] XP_007731960.1 histone H3 [Capronia epimyces CBS 606.96] XP_007759802.1 histone H3 [Cladophialophora yegresii CBS 114405] XP_007740993.1 histone H3 [Cladophialophora psammophila CBS 110553] XP_007787317.1 Histone H3 [Endocarpon pusillum Z07020] XP_007928076.1 hypothetical protein MYCFIDRAFT_76942 [Pseudocercospora fijiensis CIRAD86] XP_008087110.1 Histone-fold containing protein [Glarea lozoyensis ATCC 20868] XP_007780895.1 histone H3 [Coniosporium apollinis CBS 100218] XP_008725039.1 histone H3 [Cladophialophora carrionii CBS 160.54] XP_009154089.1 histone H3 [Exophiala dermatitidis NIH/UT8656] XP_012740301.1 histone H3 [Pseudogymnoascus destructans 20631-21] XP_013270500.1 histone H3 [Rhinocladiella mackenziei CBS 650.93] XP_013287775.1 histone H3 [Fonsecaea pedrosoi CBS 271.37] XP_013314048.1 histone H3 [Exophiala xenobiotica] XP_013343568.1 hypothetical protein AUEXF2481DRAFT_47053 [Aureobasidium subglaciale EXF-2481] XP_013428903.1 histone cluster 1, H3g protein [Aureobasidium namibiae CBS 147.97] XP_016226481.1 histone H3 [Exophiala mesophila] XP_016215309.1 histone H3 [Verruconis gallopava] XP_016230789.1 histone H3 [Exophiala spinifera] XP_016266785.1 histone H3 [Exophiala oligosperma] XP_016243834.1 histone H3 [Cladophialophora immunda] XP_016637803.1 histone H3 [Fonsecaea multimorphosa CBS 102226] XP_016624376.1 histone H3 [Cladophialophora bantiana CBS 173.52] XP_018077284.1 histone cluster 1, H3g protein [Phialocephala scopiformis] XP_018128005.1 histone H3 [Pseudogymnoascus verrucosus] XP_018190764.1 histone cluster 1, H3g protein [Xylona heveae TC161] XP_018696518.1 histone H3 [Fonsecaea erecta] AAI54937.1 LOC100127748 protein [Xenopus tropicalis] EGP86418.1 histone H3 [Zymoseptoria tritici IPO323] EHK97637.1 putative Histone H3 [Glarea lozoyensis 74030] EHY53628.1 histone H3 [Exophiala dermatitidis NIH/UT8656] EKD14693.1 histone cluster 1, H3g [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] ELR05822.1 histone H3 [Pseudogymnoascus destructans 20631-21] EMC95659.1 hypothetical protein BAUCODRAFT_34428 [Baudoinia panamericana UAMH 10762] EME42110.1 hypothetical protein DOTSEDRAFT_89592 [Dothistroma septosporum NZE10] EME81004.1 hypothetical protein MYCFIDRAFT_76942 [Pseudocercospora fijiensis CIRAD86] EON65578.1 histone H3 [Coniosporium apollinis CBS 100218] EPE25791.1 Histone-fold containing protein [Glarea lozoyensis ATCC 20868] EPQ65912.1 histone H3 protein [Blumeria graminis f. sp. tritici 96224] EPQ66293.1 hypothetical protein BGT96224_1778 [Blumeria graminis f. sp. tritici 96224] CCU82995.1 histone H3 [Blumeria graminis f. sp. hordei DH14] CCU82905.1 Histone H3 [Blumeria graminis f. sp. hordei DH14] ERF75305.1 Histone H3 [Endocarpon pusillum Z07020] ETI25694.1 histone H3 [Cladophialophora carrionii CBS 160.54] EXJ57268.1 histone H3 [Cladophialophora yegresii CBS 114405] EXJ75491.1 histone H3 [Cladophialophora psammophila CBS 110553] EXJ86681.1 histone H3 [Capronia epimyces CBS 606.96] EXJ87992.1 histone H3 [Capronia coronata CBS 617.96] KEQ61096.1 histone cluster 1, H3g protein [Aureobasidium melanogenum CBS 110374] KEQ74764.1 histone cluster 1, H3g protein [Aureobasidium namibiae CBS 147.97] KEQ79930.1 histone cluster 1, H3g protein [Aureobasidium pullulans EXF-150] KEQ94913.1 hypothetical protein AUEXF2481DRAFT_47053 [Aureobasidium subglaciale EXF-2481] KFX90910.1 hypothetical protein V490_06204 [Pseudogymnoascus sp. VKM F-3557] KFY11630.1 hypothetical protein V491_07122 [Pseudogymnoascus sp. VKM F-3775] KFY18979.1 hypothetical protein V493_08218 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] KFY32699.1 hypothetical protein V495_08820 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY43528.1 hypothetical protein V494_01929 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] KFY51481.1 hypothetical protein V497_09097 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY64841.1 hypothetical protein V496_02986 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY71342.1 hypothetical protein V499_08457 [Pseudogymnoascus sp. VKM F-103] KFY96041.1 hypothetical protein V498_02955 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] KFY98548.1 hypothetical protein V500_01622 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ16392.1 hypothetical protein V502_05116 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] KFZ16836.1 hypothetical protein V501_02045 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] KHJ30903.1 putative histone H3 [Erysiphe necator] KHJ32105.1 putative histone H3 [Erysiphe necator] KIN01453.1 hypothetical protein OIDMADRAFT_19281 [Oidiodendron maius Zn] GAM82027.1 hypothetical protein ANO11243_000060 [fungal sp. No.11243] KIV79754.1 histone H3 [Exophiala sideris] KIV94907.1 histone H3 [Exophiala mesophila] KIW05440.1 histone H3 [Verruconis gallopava] KIW10573.1 histone H3 [Exophiala spinifera] KIW23618.1 histone H3 [Cladophialophora immunda] KIW46569.1 histone H3 [Exophiala oligosperma] KIW53464.1 histone H3 [Exophiala xenobiotica] KIW65871.1 histone H3 [Capronia semi-immersa] KIW83967.1 histone H3 [Fonsecaea pedrosoi CBS 271.37] KIW97707.1 histone H3 [Cladophialophora bantiana CBS 173.52] KIX03364.1 histone H3 [Rhinocladiella mackenziei CBS 650.93] KIY03681.1 histone H3 [Fonsecaea multimorphosa CBS 102226] KJX95006.1 histone H3.3 like protein [Zymoseptoria brevis] KKY17757.1 putative histone H3 [Phaeomoniella chlamydospora] ALQ33223.1 histone H3 [Golovinomyces orontii] ALQ33224.1 histone H3 [Golovinomyces orontii] ALQ33225.1 histone H3 [Golovinomyces orontii] ALQ33226.1 histone H3 [Golovinomyces orontii] ALQ33227.1 histone H3 [Golovinomyces orontii] ALQ33228.1 histone H3 [Golovinomyces orontii] ALQ33229.1 histone H3 [Golovinomyces orontii] ALQ33230.1 histone H3 [Golovinomyces orontii] ALQ33231.1 histone H3 [Golovinomyces orontii] ALQ33232.1 histone H3 [Golovinomyces orontii] ALQ33233.1 histone H3 [Golovinomyces orontii] ALQ33234.1 histone H3 [Golovinomyces orontii] ALQ33235.1 histone H3 [Golovinomyces orontii] ALQ33236.1 histone H3 [Golovinomyces orontii] ALQ33237.1 histone H3 [Golovinomyces orontii] ALQ33238.1 histone H3 [Golovinomyces orontii] ALQ33239.1 histone H3 [Golovinomyces orontii] ALQ33240.1 histone H3 [Golovinomyces orontii] ALQ33241.1 histone H3 [Golovinomyces orontii] ALQ33242.1 histone H3 [Golovinomyces orontii] ALQ33243.1 histone H3 [Golovinomyces orontii] ALQ33244.1 histone H3 [Golovinomyces orontii] ALQ33245.1 histone H3 [Golovinomyces orontii] ALQ33246.1 histone H3 [Golovinomyces orontii] ALQ33247.1 histone H3 [Golovinomyces orontii] ALQ33248.1 histone H3 [Golovinomyces orontii] ALQ33249.1 histone H3 [Golovinomyces orontii] ALQ33250.1 histone H3 [Golovinomyces orontii] ALQ33251.1 histone H3 [Golovinomyces orontii] ALQ33252.1 histone H3 [Golovinomyces orontii] ALQ33253.1 histone H3 [Golovinomyces orontii] ALQ33254.1 histone H3 [Golovinomyces orontii] ALQ33255.1 histone H3 [Golovinomyces orontii] ALQ33256.1 histone H3 [Golovinomyces orontii] ALQ33257.1 histone H3 [Golovinomyces orontii] ALQ33258.1 histone H3 [Golovinomyces orontii] ALQ33259.1 histone H3 [Golovinomyces orontii] ALQ33260.1 histone H3 [Golovinomyces orontii] ALQ33261.1 histone H3 [Golovinomyces orontii] KUJ22929.1 histone cluster 1, H3g protein [Phialocephala scopiformis] KXL44182.1 hypothetical protein FE78DRAFT_170024 [Acidomyces richmondensis] KXT04101.1 hypothetical protein AC578_4899 [Mycosphaerella eumusae] KXT17838.1 hypothetical protein AC579_5357 [Pseudocercospora musae] KYG44830.1 hypothetical protein M433DRAFT_5122 [Acidomyces richmondensis BFW] KZF25209.1 histone cluster 1, H3g protein [Xylona heveae TC161] OAF59307.1 histone H3 [Pseudogymnoascus destructans] OAL32380.1 histone H3 [Fonsecaea multimorphosa] OAP63151.1 histone H3 [Fonsecaea erecta] OBT38839.1 histone H3 [Pseudogymnoascus sp. WSF 3629] OBT65632.1 histone H3 [Pseudogymnoascus sp. 23342-1-I1] OBT78982.1 histone H3 [Pseudogymnoascus sp. 05NY08] OBT82446.1 histone H3 [Pseudogymnoascus sp. 03VT05] OBT94272.1 histone H3 [Pseudogymnoascus verrucosus] OCT46950.1 histone H3 [Cladophialophora carrionii] CZT52688.1 Histone H3 [Rhynchosporium secalis] CZT13461.1 Histone H3 [Rhynchosporium agropyri] CZT04290.1 Histone H3 [Rhynchosporium commune] CZR52145.1 Histone H3 [Phialocephala subalpina] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_001243947.1 histone H3 [Coccidioides immitis RS] XP_002582441.1 histone H3.3 [Uncinocarpus reesii 1704] XP_003068796.1 Histone H3, putative [Coccidioides posadasii C735 delta SOWgp] Q1E225.1 RecName: Full=Histone H3 EEP82349.1 histone H3.3 [Uncinocarpus reesii 1704] EER26651.1 Histone H3, putative [Coccidioides posadasii C735 delta SOWgp] EFW20724.1 histone H3 [Coccidioides posadasii str. Silveira] EAS32364.3 histone H3 [Coccidioides immitis RS] KMM72719.1 histone H3 [Coccidioides posadasii RMSCC 3488] KMP07595.1 histone H3 [Coccidioides immitis RMSCC 2394] KMU71953.1 histone H3 [Coccidioides immitis RMSCC 3703] KMU82678.1 histone H3 [Coccidioides immitis H538.4] Length = 136 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >OJD26858.1 histone H3 [Blastomyces sp. CAC-2015b] Length = 137 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >KLJ09374.1 histone H3 [Emmonsia parva UAMH 139] Length = 137 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_002626825.1 histone H3 [Blastomyces gilchristii SLH14081] EEQ84219.1 histone H3 [Blastomyces dermatitidis ER-3] EGE80048.1 histone H3 [Blastomyces dermatitidis ATCC 18188] EQL34342.1 histone H3 [Blastomyces dermatitidis ATCC 26199] OAT06862.1 histone H3 [Blastomyces gilchristii SLH14081] Length = 137 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 136 >XP_001727504.2 histone H3 [Aspergillus oryzae RIB40] Length = 139 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 39 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 98 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 99 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 139 >XP_658337.1 H3_EMENI Histone H3 [Aspergillus nidulans FGSC A4] EAA65375.1 H3_EMENI Histone H3 [Aspergillus nidulans FGSC A4] Length = 141 Score = 196 bits (498), Expect = 3e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 41 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 100 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 101 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 141 >XP_011110360.1 hypothetical protein H072_4460 [Dactylellina haptotyla CBS 200.50] XP_011125467.1 hypothetical protein AOL_s00117g2 [Arthrobotrys oligospora ATCC 24927] EGX45797.1 hypothetical protein AOL_s00117g2 [Arthrobotrys oligospora ATCC 24927] EPS41641.1 hypothetical protein H072_4460 [Dactylellina haptotyla CBS 200.50] EWC46145.1 histone H3 [Drechslerella stenobrocha 248] Length = 136 Score = 195 bits (495), Expect = 8e-62 Identities = 100/101 (99%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQ+KDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQNKDIQLARRLRGERS 136 >XP_017995755.1 histone H3 [Phialophora attae] KPI35792.1 histone H3 [Phialophora attae] Length = 171 Score = 196 bits (498), Expect = 9e-62 Identities = 101/101 (100%), Positives = 101/101 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 71 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 130 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS Sbjct: 131 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 171 >XP_001548662.1 histone H3 [Botrytis cinerea B05.10] XP_001589886.1 histone H3 [Sclerotinia sclerotiorum 1980] XP_001941889.1 histone H3 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003302878.1 hypothetical protein PTT_14862 [Pyrenophora teres f. teres 0-1] XP_003845436.1 similar to histone H3.3 [Leptosphaeria maculans JN3] XP_007682285.1 hypothetical protein COCMIDRAFT_79619 [Bipolaris oryzae ATCC 44560] XP_007697545.1 hypothetical protein COCSADRAFT_34966 [Bipolaris sorokiniana ND90Pr] XP_007716344.1 hypothetical protein COCCADRAFT_40258 [Bipolaris zeicola 26-R-13] XP_008027488.1 hypothetical protein SETTUDRAFT_163756 [Setosphaeria turcica Et28A] XP_014078422.1 hypothetical protein COCC4DRAFT_41284 [Bipolaris maydis ATCC 48331] XP_014551515.1 hypothetical protein COCVIDRAFT_20249 [Bipolaris victoriae FI3] XP_018380551.1 histone-fold-containing protein [Alternaria alternata] Q0UY45.1 RecName: Full=Histone H3 EDN93741.1 histone H3 [Sclerotinia sclerotiorum 1980 UF-70] EDU44608.1 histone H3 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ89054.1 hypothetical protein PTT_14862 [Pyrenophora teres f. teres 0-1] CBY01957.1 similar to histone H3.3 [Leptosphaeria maculans JN3] CCD46913.1 similar to histone H3.3 [Botrytis cinerea T4] EMD66446.1 hypothetical protein COCSADRAFT_34966 [Bipolaris sorokiniana ND90Pr] EMD84642.1 hypothetical protein COCHEDRAFT_1122518 [Bipolaris maydis C5] EMD97023.1 hypothetical protein COCHEDRAFT_10216 [Bipolaris maydis C5] EMR82379.1 putative histone h3 protein [Botrytis cinerea BcDW1] ENI04513.1 hypothetical protein COCC4DRAFT_41284 [Bipolaris maydis ATCC 48331] EOA84992.1 hypothetical protein SETTUDRAFT_163756 [Setosphaeria turcica Et28A] ESZ94719.1 histone 3 [Sclerotinia borealis F-4128] EUC29360.1 hypothetical protein COCCADRAFT_40258 [Bipolaris zeicola 26-R-13] EUC51434.1 hypothetical protein COCMIDRAFT_79619 [Bipolaris oryzae ATCC 44560] EUN21968.1 hypothetical protein COCVIDRAFT_20249 [Bipolaris victoriae FI3] KNG50511.1 histone H3 [Stemphylium lycopersici] KZM26197.1 hypothetical protein ST47_g2701 [Ascochyta rabiei] OAG15130.1 histone-fold-containing protein [Alternaria alternata] OAL01475.1 histone-fold-containing protein [Stagonospora sp. SRC1lsM3a] OAL45106.1 histone-fold-containing protein [Pyrenochaeta sp. DS3sAY3a] OCK79208.1 histone-fold-containing protein [Lepidopterella palustris CBS 459.81] OCK94332.1 histone-fold-containing protein [Cenococcum geophilum 1.58] OCL04791.1 histone-fold-containing protein [Glonium stellatum] APA15589.1 hypothetical protein sscle_15g103590 [Sclerotinia sclerotiorum 1980 UF-70] Length = 136 Score = 194 bits (494), Expect = 1e-61 Identities = 100/100 (100%), Positives = 100/100 (100%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGER 136 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGER Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGER 135 >KZZ93205.1 histone H3 [Ascosphaera apis ARSEF 7405] Length = 136 Score = 194 bits (493), Expect = 2e-61 Identities = 100/101 (99%), Positives = 100/101 (99%) Frame = -3 Query: 435 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 256 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE Sbjct: 36 VKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQE 95 Query: 255 SVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERS 133 SVEAYLVSLFEDTNLCAIHAKRVTIQ KDIQLARRLRGERS Sbjct: 96 SVEAYLVSLFEDTNLCAIHAKRVTIQPKDIQLARRLRGERS 136