BLASTX nr result
ID: Magnolia22_contig00002597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002597 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006853865.1 PREDICTED: heat shock factor protein HSF30 [Ambor... 53 6e-06 >XP_006853865.1 PREDICTED: heat shock factor protein HSF30 [Amborella trichopoda] ERN15332.1 hypothetical protein AMTR_s00036p00115830 [Amborella trichopoda] Length = 368 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 321 EIDVEVEDLAARPSDWSDNVQVLAEQMGFLGSKP 220 EI+VEVEDL A+ S W D+VQVL EQMGF+G KP Sbjct: 335 EIEVEVEDLQAKSSTWDDDVQVLVEQMGFVGPKP 368