BLASTX nr result
ID: Magnolia22_contig00002545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002545 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABS10818.1 glutathione S-transferase, partial [Gossypium barbade... 52 6e-06 >ABS10818.1 glutathione S-transferase, partial [Gossypium barbadense] Length = 180 Score = 52.4 bits (124), Expect = 6e-06 Identities = 31/64 (48%), Positives = 40/64 (62%) Frame = +3 Query: 147 FTYKCTRRPRFLKQPPPPRIYQTTFPSKKSTKISLQAMATGKLQEVLPPVLDSTSEPPPT 326 F++ C R +F +PP P S K T IS AM++G +QE LPP LDSTS+PPP Sbjct: 46 FSFHCKTRTQFPFRPPLPA-------SNKPTTIS-SAMSSGYVQEDLPPALDSTSDPPP- 96 Query: 327 LFDG 338 +FDG Sbjct: 97 IFDG 100