BLASTX nr result
ID: Magnolia22_contig00001381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00001381 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010261733.1 PREDICTED: dormancy-associated protein homolog 4 ... 53 2e-06 XP_006843845.1 PREDICTED: auxin-repressed 12.5 kDa protein isofo... 52 4e-06 XP_003632757.1 PREDICTED: dormancy-associated protein homolog 4 ... 52 8e-06 >XP_010261733.1 PREDICTED: dormancy-associated protein homolog 4 [Nelumbo nucifera] Length = 125 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 386 RRKSTSEAYDRAEPRYPTVYDWVVIGALDR 297 RRKSTSE +RA+PR PTVYDWVVI ALDR Sbjct: 96 RRKSTSEVLERAQPRSPTVYDWVVISALDR 125 >XP_006843845.1 PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Amborella trichopoda] ERN05520.1 hypothetical protein AMTR_s00007p00261640 [Amborella trichopoda] Length = 121 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 386 RRKSTSEAYDRAEPRYPTVYDWVVIGALDR 297 R KSTSEA ++AEPR PTVYDWVVI ALDR Sbjct: 92 RMKSTSEALEKAEPRSPTVYDWVVISALDR 121 >XP_003632757.1 PREDICTED: dormancy-associated protein homolog 4 isoform X2 [Vitis vinifera] CBI35822.3 unnamed protein product, partial [Vitis vinifera] Length = 126 Score = 51.6 bits (122), Expect = 8e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 386 RRKSTSEAYDRAEPRYPTVYDWVVIGALDR 297 RRK+ EA++RAEPR PTVYDW+VI ALDR Sbjct: 97 RRKAALEAFERAEPRSPTVYDWIVISALDR 126