BLASTX nr result
ID: Magnolia22_contig00001314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00001314 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013256373.1 hypothetical protein A1O9_10184 [Exophiala aquama... 77 7e-16 XP_016630055.1 hypothetical protein Z520_08187 [Fonsecaea multim... 74 8e-15 KXT07198.1 hypothetical protein AC578_2470 [Mycosphaerella eumusae] 73 3e-14 XP_016622249.1 hypothetical protein Z519_04165 [Cladophialophora... 73 4e-14 XP_013285162.1 hypothetical protein Z517_04379 [Fonsecaea pedros... 72 5e-14 OAL29157.1 hypothetical protein AYO20_09310 [Fonsecaea nubica] 72 9e-14 XP_016250718.1 hypothetical protein PV07_06244 [Cladophialophora... 72 9e-14 OAG41012.1 hypothetical protein AYO21_04854 [Fonsecaea monophora] 72 1e-13 XP_013288248.1 hypothetical protein Z517_03690 [Fonsecaea pedros... 71 1e-13 XP_009157684.1 hypothetical protein HMPREF1120_05269 [Exophiala ... 71 2e-13 KXT17480.1 hypothetical protein AC579_5694 [Pseudocercospora musae] 71 2e-13 XP_018689649.1 hypothetical protein AYL99_09461 [Fonsecaea erect... 70 3e-13 XP_016636445.1 hypothetical protein Z520_02461 [Fonsecaea multim... 70 5e-13 XP_016255137.1 hypothetical protein PV07_01662 [Cladophialophora... 70 5e-13 XP_007750867.1 hypothetical protein A1O5_12108 [Cladophialophora... 69 7e-13 XP_007748771.1 hypothetical protein A1O5_10003 [Cladophialophora... 69 1e-12 XP_016613741.1 hypothetical protein Z519_12369 [Cladophialophora... 69 1e-12 XP_007600128.1 ethyl tert-butyl ether degradation EthD [Colletot... 67 2e-12 XP_016262627.1 hypothetical protein PV06_05966 [Exophiala oligos... 68 3e-12 XP_007923410.1 hypothetical protein MYCFIDRAFT_132791 [Pseudocer... 68 3e-12 >XP_013256373.1 hypothetical protein A1O9_10184 [Exophiala aquamarina CBS 119918] KEF53783.1 hypothetical protein A1O9_10184 [Exophiala aquamarina CBS 119918] Length = 107 Score = 77.0 bits (188), Expect = 7e-16 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 + ++ G DG+KP Y VQA L++DS ED KA S +AK VF DIPNF+NKQPVL+GG+V Sbjct: 44 ITEYGPGGDGAKPAYHVQAMLVFDSQEDLGKALGSEDAKPVFADIPNFTNKQPVLMGGNV 103 Query: 183 L 185 + Sbjct: 104 V 104 >XP_016630055.1 hypothetical protein Z520_08187 [Fonsecaea multimorphosa CBS 102226] KIX95932.1 hypothetical protein Z520_08187 [Fonsecaea multimorphosa CBS 102226] OAL21703.1 hypothetical protein AYO22_07645 [Fonsecaea multimorphosa] Length = 107 Score = 74.3 bits (181), Expect = 8e-15 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V+++ G DG+KP+Y AT+IWD ED A S +AK VFGDI NF+NKQPV + G + Sbjct: 44 VLEYKPGLDGAKPLYIASATMIWDKPEDMGAALTSEDAKPVFGDIQNFTNKQPVFLAGDL 103 Query: 183 LKTA 194 +KT+ Sbjct: 104 VKTS 107 >KXT07198.1 hypothetical protein AC578_2470 [Mycosphaerella eumusae] Length = 113 Score = 73.2 bits (178), Expect = 3e-14 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = +3 Query: 3 VIQFSEG-PDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGS 179 V +F G P GSKP+Y V TL+W S E KAF A+ +FGD+PNFSNK+P+L+ G Sbjct: 44 VAKFQSGHPPGSKPLYSVACTLVWQSQEHAQKAFAHEAAQHIFGDVPNFSNKEPILLAGD 103 Query: 180 VLKTA 194 V+KT+ Sbjct: 104 VVKTS 108 >XP_016622249.1 hypothetical protein Z519_04165 [Cladophialophora bantiana CBS 173.52] KIW95580.1 hypothetical protein Z519_04165 [Cladophialophora bantiana CBS 173.52] Length = 109 Score = 72.8 bits (177), Expect = 4e-14 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 + +F DG+KPVY +Q LIWD+ E KA SPEA VFGD+ NF NKQP+ +GG V Sbjct: 44 ITKFGPNADGTKPVYALQTLLIWDNAECVKKAMLSPEAPVVFGDVANFCNKQPIAMGGDV 103 Query: 183 L 185 L Sbjct: 104 L 104 >XP_013285162.1 hypothetical protein Z517_04379 [Fonsecaea pedrosoi CBS 271.37] KIW81354.1 hypothetical protein Z517_04379 [Fonsecaea pedrosoi CBS 271.37] OAG36559.1 hypothetical protein AYO21_09216 [Fonsecaea monophora] Length = 106 Score = 72.4 bits (176), Expect = 5e-14 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQF PDG+KP Y V A L W++ + KA +S EA+TVFGD+PNFSNK P+ + G + Sbjct: 44 VIQFQAAPDGTKP-YSVSALLTWETADGLKKALSSEEAQTVFGDVPNFSNKSPLFIAGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >OAL29157.1 hypothetical protein AYO20_09310 [Fonsecaea nubica] Length = 106 Score = 71.6 bits (174), Expect = 9e-14 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQF PDG+KP Y V A L W++ + KA +S EA+TVFGD+PNFSNK P+ + G + Sbjct: 44 VIQFQAAPDGTKP-YSVGALLTWETADGLKKALSSQEAQTVFGDVPNFSNKSPLFIAGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >XP_016250718.1 hypothetical protein PV07_06244 [Cladophialophora immunda] KIW30502.1 hypothetical protein PV07_06244 [Cladophialophora immunda] Length = 107 Score = 71.6 bits (174), Expect = 9e-14 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V+++ G DG+KP + V ATLIWD+ + A S +AK VFGDIPNF NKQPV +GG + Sbjct: 44 VLEYKPGGDGAKPKFCVGATLIWDTPDQLGAALASEDAKPVFGDIPNFCNKQPVFLGGEL 103 Query: 183 LKTA 194 + T+ Sbjct: 104 VGTS 107 >OAG41012.1 hypothetical protein AYO21_04854 [Fonsecaea monophora] Length = 109 Score = 71.6 bits (174), Expect = 1e-13 Identities = 31/66 (46%), Positives = 45/66 (68%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V+++ GPDG+ P + V TL+WDS E A +S +AK V GDIPNF NKQP+ +GG + Sbjct: 44 VLEYKPGPDGTPPKFVVGGTLVWDSPEQMGAAMSSEDAKPVLGDIPNFCNKQPIFLGGPL 103 Query: 183 LKTASH 200 + +S+ Sbjct: 104 VAKSSY 109 >XP_013288248.1 hypothetical protein Z517_03690 [Fonsecaea pedrosoi CBS 271.37] KIW84440.1 hypothetical protein Z517_03690 [Fonsecaea pedrosoi CBS 271.37] OAL21430.1 hypothetical protein AYO20_11367 [Fonsecaea nubica] Length = 109 Score = 71.2 bits (173), Expect = 1e-13 Identities = 31/66 (46%), Positives = 44/66 (66%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V+++ GPDG+ P + V TL+WDS E A S +AK V GDIPNF NKQP+ +GG + Sbjct: 44 VLEYKPGPDGTPPKFVVGGTLVWDSPEQMGAAMTSEDAKPVLGDIPNFCNKQPIFLGGPL 103 Query: 183 LKTASH 200 + +S+ Sbjct: 104 VAKSSY 109 >XP_009157684.1 hypothetical protein HMPREF1120_05269 [Exophiala dermatitidis NIH/UT8656] EHY57223.1 hypothetical protein HMPREF1120_05269 [Exophiala dermatitidis NIH/UT8656] Length = 106 Score = 70.9 bits (172), Expect = 2e-13 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V+QF+ PDGSKP Y V A L WDS E KA NS EAK V GD+ NFSNK P+ + G + Sbjct: 44 VVQFAAAPDGSKP-YSVAALLTWDSVESIHKALNSEEAKIVLGDVQNFSNKGPLFLPGDI 102 Query: 183 LKTA 194 + T+ Sbjct: 103 VGTS 106 >KXT17480.1 hypothetical protein AC579_5694 [Pseudocercospora musae] Length = 113 Score = 70.9 bits (172), Expect = 2e-13 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 3 VIQFSEG-PDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGS 179 V +F G P GSKP+Y V TL+W S E KA A+ VF D+PNFSNK+P+L+ G Sbjct: 44 VAKFESGHPPGSKPLYSVATTLVWQSREHAEKALTHESAQQVFSDVPNFSNKEPILLAGD 103 Query: 180 VLKTA 194 ++KTA Sbjct: 104 IVKTA 108 >XP_018689649.1 hypothetical protein AYL99_09461 [Fonsecaea erecta] OAP56282.1 hypothetical protein AYL99_09461 [Fonsecaea erecta] Length = 106 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQF PDG+KP Y + A L WD + KA S EA TVFGD+PNFSNK P+ + G + Sbjct: 44 VIQFQPAPDGAKP-YSIGALLTWDDADGLKKALASKEAATVFGDVPNFSNKSPLFIAGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >XP_016636445.1 hypothetical protein Z520_02461 [Fonsecaea multimorphosa CBS 102226] KIY02323.1 hypothetical protein Z520_02461 [Fonsecaea multimorphosa CBS 102226] OAL28967.1 hypothetical protein AYO22_02403 [Fonsecaea multimorphosa] Length = 106 Score = 69.7 bits (169), Expect = 5e-13 Identities = 31/64 (48%), Positives = 42/64 (65%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQ+ PDGSKP Y++ A L W+S + A EA TVFGD+PNFSNK P+ + G + Sbjct: 44 VIQYQTAPDGSKP-YNIGALLTWESADGLKNALAGEEAATVFGDVPNFSNKSPIFIAGDI 102 Query: 183 LKTA 194 + T+ Sbjct: 103 VGTS 106 >XP_016255137.1 hypothetical protein PV07_01662 [Cladophialophora immunda] KIW34921.1 hypothetical protein PV07_01662 [Cladophialophora immunda] Length = 106 Score = 69.7 bits (169), Expect = 5e-13 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V++F PDGSKP Y + A L W++ + +A +S EA+TVFGD+PNFSNK P+ + G + Sbjct: 44 VVEFQAAPDGSKP-YSIAALLTWETADGLKQALSSQEAQTVFGDVPNFSNKSPLFIAGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >XP_007750867.1 hypothetical protein A1O5_12108 [Cladophialophora psammophila CBS 110553] EXJ59483.1 hypothetical protein A1O5_12108 [Cladophialophora psammophila CBS 110553] Length = 106 Score = 69.3 bits (168), Expect = 7e-13 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQ GPDGSKP Y V A L W+S + KA EA+TVFGD+PNFSN+ P+ + G + Sbjct: 44 VIQLLPGPDGSKP-YSVAALLTWESADGLSKALKGDEAQTVFGDVPNFSNRSPIFLMGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >XP_007748771.1 hypothetical protein A1O5_10003 [Cladophialophora psammophila CBS 110553] EXJ66808.1 hypothetical protein A1O5_10003 [Cladophialophora psammophila CBS 110553] Length = 109 Score = 68.9 bits (167), Expect = 1e-12 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V +F DG+KP Y +Q LIWD+ E +A SPEA VFGD+ NF NKQP+ +GG V Sbjct: 44 VTKFGPNADGTKPSYALQTLLIWDNAECVKRAMVSPEAAIVFGDVVNFCNKQPIAMGGDV 103 Query: 183 L 185 L Sbjct: 104 L 104 >XP_016613741.1 hypothetical protein Z519_12369 [Cladophialophora bantiana CBS 173.52] KIW87072.1 hypothetical protein Z519_12369 [Cladophialophora bantiana CBS 173.52] Length = 106 Score = 68.6 bits (166), Expect = 1e-12 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 VIQ GPDGSKP Y V A L W+S + KA S EA+ VFGD+PNFSNK P+ + G + Sbjct: 44 VIQLLPGPDGSKP-YSVAALLTWESADGLGKALKSDEAQAVFGDVPNFSNKSPLFLMGDI 102 Query: 183 L 185 + Sbjct: 103 V 103 >XP_007600128.1 ethyl tert-butyl ether degradation EthD [Colletotrichum fioriniae PJ7] EXF76263.1 ethyl tert-butyl ether degradation EthD [Colletotrichum fioriniae PJ7] Length = 72 Score = 67.4 bits (163), Expect = 2e-12 Identities = 30/62 (48%), Positives = 40/62 (64%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSV 182 V +F G DG+ P+Y +T+ WDS + AF PEA + GD+PNFSNKQP+ + G V Sbjct: 6 VTKFQPGADGTPPLYAFGSTVTWDSLQQIKAAFAGPEAGGIMGDVPNFSNKQPIFLTGEV 65 Query: 183 LK 188 LK Sbjct: 66 LK 67 >XP_016262627.1 hypothetical protein PV06_05966 [Exophiala oligosperma] KIW42411.1 hypothetical protein PV06_05966 [Exophiala oligosperma] Length = 108 Score = 67.8 bits (164), Expect = 3e-12 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +3 Query: 3 VIQFSEGPDGSKPVYDVQATLIWDSGEDFLKAFNS-PEAKTVFGDIPNFSNKQPVLVGGS 179 V ++ GPDG+KP Y TLIWD ED A S +A +FGDIPNFSN QP+++ G Sbjct: 44 VTEYKPGPDGAKPKYSTSGTLIWDKPEDVQTAMGSGDDAAAIFGDIPNFSNVQPIILSGP 103 Query: 180 VL 185 ++ Sbjct: 104 IV 105 >XP_007923410.1 hypothetical protein MYCFIDRAFT_132791 [Pseudocercospora fijiensis CIRAD86] EME85973.1 hypothetical protein MYCFIDRAFT_132791 [Pseudocercospora fijiensis CIRAD86] Length = 110 Score = 67.8 bits (164), Expect = 3e-12 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +3 Query: 24 PDGSKPVYDVQATLIWDSGEDFLKAFNSPEAKTVFGDIPNFSNKQPVLVGGSVLKTA 194 P G+KP+Y V TL+W S E KA + VFGD+PNFSNK+P+L+ G V+KT+ Sbjct: 49 PSGTKPLYSVACTLVWQSREHAEKAMAHESTQQVFGDVPNFSNKEPILLAGDVVKTS 105