BLASTX nr result
ID: Magnolia22_contig00000882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000882 (509 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010936482.1 PREDICTED: probable small nuclear ribonucleoprote... 97 2e-23 XP_006851429.1 PREDICTED: probable small nuclear ribonucleoprote... 96 5e-23 XP_010275175.1 PREDICTED: probable small nuclear ribonucleoprote... 95 2e-22 XP_008794214.1 PREDICTED: probable small nuclear ribonucleoprote... 94 2e-22 XP_002463169.1 hypothetical protein SORBIDRAFT_02g039000 [Sorghu... 94 3e-22 XP_008797575.1 PREDICTED: probable small nuclear ribonucleoprote... 93 6e-22 XP_020083106.1 probable small nuclear ribonucleoprotein G [Anana... 93 6e-22 KDO70466.1 hypothetical protein CISIN_1g0348952mg, partial [Citr... 93 6e-22 XP_010936954.1 PREDICTED: probable small nuclear ribonucleoprote... 93 8e-22 OAY76742.1 putative small nuclear ribonucleoprotein G [Ananas co... 93 8e-22 XP_006430167.1 hypothetical protein CICLE_v10013235mg [Citrus cl... 93 9e-22 XP_018677453.1 PREDICTED: probable small nuclear ribonucleoprote... 92 9e-22 XP_018677452.1 PREDICTED: probable small nuclear ribonucleoprote... 92 9e-22 XP_009387876.1 PREDICTED: probable small nuclear ribonucleoprote... 92 1e-21 OAY81593.1 putative small nuclear ribonucleoprotein G [Ananas co... 92 1e-21 XP_015647578.1 PREDICTED: probable small nuclear ribonucleoprote... 92 1e-21 OEL31083.1 putative small nuclear ribonucleoprotein G [Dichanthe... 93 1e-21 AAT08690.1 small nuclear ribonucleoprotein polypeptide G, partia... 93 1e-21 AAK55776.1 Putative small nuclear ribonucleoprotein G [Oryza sat... 92 2e-21 ACL52721.1 unknown [Zea mays] AQL06038.1 putative small nuclear ... 91 4e-21 >XP_010936482.1 PREDICTED: probable small nuclear ribonucleoprotein G [Elaeis guineensis] Length = 80 Score = 97.1 bits (240), Expect = 2e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 80 >XP_006851429.1 PREDICTED: probable small nuclear ribonucleoprotein G [Amborella trichopoda] ERN13010.1 hypothetical protein AMTR_s00040p00092540 [Amborella trichopoda] Length = 80 Score = 95.9 bits (237), Expect = 5e-23 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNE+NDIGMVVIRGNSVVMIEALEPVSKTQ Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNERNDIGMVVIRGNSVVMIEALEPVSKTQ 80 >XP_010275175.1 PREDICTED: probable small nuclear ribonucleoprotein G [Nelumbo nucifera] Length = 80 Score = 94.7 bits (234), Expect = 2e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLV+DNT+E NGNEKNDIGMVVIRGNSVVMIEALEPV+KTQ Sbjct: 32 LRGFDQFMNLVVDNTVEANGNEKNDIGMVVIRGNSVVMIEALEPVNKTQ 80 >XP_008794214.1 PREDICTED: probable small nuclear ribonucleoprotein G [Phoenix dactylifera] Length = 80 Score = 94.4 bits (233), Expect = 2e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV +TQ Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVGRTQ 80 >XP_002463169.1 hypothetical protein SORBIDRAFT_02g039000 [Sorghum bicolor] EER99690.1 hypothetical protein SORBI_002G371200 [Sorghum bicolor] Length = 80 Score = 94.0 bits (232), Expect = 3e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV+K Q Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVAKAQ 80 >XP_008797575.1 PREDICTED: probable small nuclear ribonucleoprotein G [Phoenix dactylifera] Length = 79 Score = 93.2 bits (230), Expect = 6e-22 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKT 71 LRGFDQFMNLVIDNT+E+NG+EKNDIGMVVIRGNSVVMIEALEPVSKT Sbjct: 32 LRGFDQFMNLVIDNTVEVNGSEKNDIGMVVIRGNSVVMIEALEPVSKT 79 >XP_020083106.1 probable small nuclear ribonucleoprotein G [Ananas comosus] Length = 80 Score = 93.2 bits (230), Expect = 6e-22 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKN+IGMVVIRGNSVVMIEALEPV++TQ Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNEKNEIGMVVIRGNSVVMIEALEPVARTQ 80 >KDO70466.1 hypothetical protein CISIN_1g0348952mg, partial [Citrus sinensis] KDO70467.1 hypothetical protein CISIN_1g0348952mg, partial [Citrus sinensis] Length = 68 Score = 92.8 bits (229), Expect = 6e-22 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKNDIGMVVIRGNSVV +EALEPVSK+Q Sbjct: 20 LRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVSKSQ 68 >XP_010936954.1 PREDICTED: probable small nuclear ribonucleoprotein G [Elaeis guineensis] Length = 79 Score = 92.8 bits (229), Expect = 8e-22 Identities = 44/48 (91%), Positives = 48/48 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKT 71 LRGFDQFMNLV+DNT+E+NG+EKNDIGMVVIRGNSVVMIEALEPVSKT Sbjct: 32 LRGFDQFMNLVVDNTVEVNGSEKNDIGMVVIRGNSVVMIEALEPVSKT 79 >OAY76742.1 putative small nuclear ribonucleoprotein G [Ananas comosus] Length = 92 Score = 93.2 bits (230), Expect = 8e-22 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKN+IGMVVIRGNSVVMIEALEPV++TQ Sbjct: 44 LRGFDQFMNLVIDNTVEVNGNEKNEIGMVVIRGNSVVMIEALEPVARTQ 92 >XP_006430167.1 hypothetical protein CICLE_v10013235mg [Citrus clementina] XP_006481749.1 PREDICTED: probable small nuclear ribonucleoprotein G [Citrus sinensis] ESR43407.1 hypothetical protein CICLE_v10013235mg [Citrus clementina] Length = 80 Score = 92.8 bits (229), Expect = 9e-22 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGNEKNDIGMVVIRGNSVV +EALEPVSK+Q Sbjct: 32 LRGFDQFMNLVIDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVSKSQ 80 >XP_018677453.1 PREDICTED: probable small nuclear ribonucleoprotein G isoform X3 [Musa acuminata subsp. malaccensis] Length = 69 Score = 92.4 bits (228), Expect = 9e-22 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKT 71 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV++T Sbjct: 22 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVART 69 >XP_018677452.1 PREDICTED: probable small nuclear ribonucleoprotein G isoform X2 [Musa acuminata subsp. malaccensis] Length = 70 Score = 92.4 bits (228), Expect = 9e-22 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKT 71 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV++T Sbjct: 23 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVART 70 >XP_009387876.1 PREDICTED: probable small nuclear ribonucleoprotein G isoform X1 [Musa acuminata subsp. malaccensis] Length = 79 Score = 92.4 bits (228), Expect = 1e-21 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKT 71 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV++T Sbjct: 32 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVART 79 >OAY81593.1 putative small nuclear ribonucleoprotein G [Ananas comosus] Length = 80 Score = 92.4 bits (228), Expect = 1e-21 Identities = 42/49 (85%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEP++++Q Sbjct: 32 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPIARSQ 80 >XP_015647578.1 PREDICTED: probable small nuclear ribonucleoprotein G [Oryza sativa Japonica Group] BAC84637.1 putative small nuclear ribonucleoprotein E [Oryza sativa Japonica Group] BAH01409.1 unnamed protein product [Oryza sativa Japonica Group] EEC82426.1 hypothetical protein OsI_26821 [Oryza sativa Indica Group] EEE67563.1 hypothetical protein OsJ_25073 [Oryza sativa Japonica Group] BAT02589.1 Os07g0608700 [Oryza sativa Japonica Group] Length = 80 Score = 92.4 bits (228), Expect = 1e-21 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV K Q Sbjct: 32 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVPKPQ 80 >OEL31083.1 putative small nuclear ribonucleoprotein G [Dichanthelium oligosanthes] Length = 93 Score = 92.8 bits (229), Expect = 1e-21 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGN+KNDIGMVVIRGNSVVMIEALEPV+K Q Sbjct: 45 LRGFDQFMNLVIDNTVEVNGNDKNDIGMVVIRGNSVVMIEALEPVAKAQ 93 >AAT08690.1 small nuclear ribonucleoprotein polypeptide G, partial [Hyacinthus orientalis] Length = 96 Score = 92.8 bits (229), Expect = 1e-21 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGN+KNDIGMVVIRGNSVVMIEALEPV++TQ Sbjct: 48 LRGFDQFMNLVIDNTMEVNGNDKNDIGMVVIRGNSVVMIEALEPVARTQ 96 >AAK55776.1 Putative small nuclear ribonucleoprotein G [Oryza sativa] Length = 94 Score = 92.4 bits (228), Expect = 2e-21 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLV+DNT+E+NGNEKNDIGMVVIRGNSVVMIEALEPV K Q Sbjct: 46 LRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVMIEALEPVPKPQ 94 >ACL52721.1 unknown [Zea mays] AQL06038.1 putative small nuclear ribonucleoprotein G [Zea mays] Length = 74 Score = 90.9 bits (224), Expect = 4e-21 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -2 Query: 214 LRGFDQFMNLVIDNTIELNGNEKNDIGMVVIRGNSVVMIEALEPVSKTQ 68 LRGFDQFMNLVIDNT+E+NGN+K DIGMVVIRGNSVVMIEALEPV+K+Q Sbjct: 26 LRGFDQFMNLVIDNTVEVNGNDKTDIGMVVIRGNSVVMIEALEPVAKSQ 74