BLASTX nr result
ID: Magnolia22_contig00000466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000466 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH98950.1 Ribosomal protein L29 [Cynara cardunculus var. scolymus] 91 3e-24 XP_006840519.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 96 2e-22 XP_011040030.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 93 2e-21 XP_015882637.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 94 2e-21 XP_011040021.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 93 3e-21 XP_008453113.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 93 3e-21 XP_004138121.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 93 3e-21 XP_008239727.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 93 4e-21 XP_007209750.1 hypothetical protein PRUPE_ppa013066mg [Prunus pe... 93 4e-21 XP_002320251.1 ribosomal protein L29 [Populus trichocarpa] ABK93... 93 4e-21 XP_002283452.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 92 7e-21 XP_010111539.1 39S ribosomal protein L47 [Morus notabilis] EXC31... 92 1e-20 CDP18073.1 unnamed protein product [Coffea canephora] 92 1e-20 XP_010259749.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 91 2e-20 XP_009397507.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 90 5e-20 JAU04797.1 39S ribosomal protein L47, mitochondrial [Noccaea cae... 89 9e-20 XP_002889667.1 ribosomal protein L29 family protein [Arabidopsis... 89 9e-20 XP_006292012.1 hypothetical protein CARUB_v10018201mg [Capsella ... 89 9e-20 XP_009118414.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 89 9e-20 XP_017255534.1 PREDICTED: 39S ribosomal protein L47, mitochondri... 89 1e-19 >KVH98950.1 Ribosomal protein L29 [Cynara cardunculus var. scolymus] Length = 127 Score = 90.5 bits (223), Expect(2) = 3e-24 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++ RT +NPLEEFFEADR+ +EDKPVVYGRSWKASELRLKSWDDL KL Sbjct: 26 AASTVRTAHNPLEEFFEADRNPEEDKPVVYGRSWKASELRLKSWDDLHKL 75 Score = 48.9 bits (115), Expect(2) = 3e-24 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +2 Query: 224 KHVLTERAIAEADPRRSAEMKRMINAL 304 KHVLTERAI + DPRR+AEMKRMINAL Sbjct: 101 KHVLTERAIEDPDPRRTAEMKRMINAL 127 >XP_006840519.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621917.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621918.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621919.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621920.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] XP_011621921.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Amborella trichopoda] ERN02194.1 hypothetical protein AMTR_s00045p00206320 [Amborella trichopoda] Length = 139 Score = 95.9 bits (237), Expect = 2e-22 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAASAR T+NPLEEFFE DRS DEDKPVVYGR WKASELRLKSWDDLQKL Sbjct: 22 AAASARVTHNPLEEFFEVDRSPDEDKPVVYGRGWKASELRLKSWDDLQKL 71 >XP_011040030.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like isoform X2 [Populus euphratica] Length = 121 Score = 93.2 bits (230), Expect = 2e-21 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAA+A + +NPLEEFFEADRS DEDKPVVYGRSWKASELRLKSWDDLQKL Sbjct: 25 AAATATSGHNPLEEFFEADRSQDEDKPVVYGRSWKASELRLKSWDDLQKL 74 >XP_015882637.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Ziziphus jujuba] Length = 143 Score = 93.6 bits (231), Expect = 2e-21 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 A++S+RT YNPLEEFFEADRS DE+KP+VYGRSWKASELRLKSWDDL KL Sbjct: 26 ASSSSRTVYNPLEEFFEADRSPDEEKPIVYGRSWKASELRLKSWDDLNKL 75 >XP_011040021.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like isoform X1 [Populus euphratica] Length = 142 Score = 93.2 bits (230), Expect = 3e-21 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAA+A + +NPLEEFFEADRS DEDKPVVYGRSWKASELRLKSWDDLQKL Sbjct: 25 AAATATSGHNPLEEFFEADRSQDEDKPVVYGRSWKASELRLKSWDDLQKL 74 >XP_008453113.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Cucumis melo] Length = 143 Score = 93.2 bits (230), Expect = 3e-21 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAA+ART YNPLEEFFEADRS D+ KPVVYGRSWKASELRLKSWDDL KL Sbjct: 26 AAATARTGYNPLEEFFEADRSPDDGKPVVYGRSWKASELRLKSWDDLNKL 75 >XP_004138121.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Cucumis sativus] KGN63602.1 hypothetical protein Csa_1G005630 [Cucumis sativus] Length = 143 Score = 93.2 bits (230), Expect = 3e-21 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAA+ART YNPLEEFFEADRS D+ KPVVYGRSWKASELRLKSWDDL KL Sbjct: 26 AAATARTGYNPLEEFFEADRSPDDGKPVVYGRSWKASELRLKSWDDLNKL 75 >XP_008239727.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Prunus mume] Length = 141 Score = 92.8 bits (229), Expect = 4e-21 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 1/51 (1%) Frame = +1 Query: 1 AAASARTT-YNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAASARTT +NPLEEFFEADRS DE+KPVVYGRSWKASELRLKSWDDL KL Sbjct: 23 AAASARTTGHNPLEEFFEADRSQDEEKPVVYGRSWKASELRLKSWDDLNKL 73 >XP_007209750.1 hypothetical protein PRUPE_ppa013066mg [Prunus persica] ONI08424.1 hypothetical protein PRUPE_5G177600 [Prunus persica] Length = 141 Score = 92.8 bits (229), Expect = 4e-21 Identities = 46/51 (90%), Positives = 48/51 (94%), Gaps = 1/51 (1%) Frame = +1 Query: 1 AAASARTT-YNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAASARTT +NPLEEFFEADRS DE+KPVVYGRSWKASELRLKSWDDL KL Sbjct: 23 AAASARTTGHNPLEEFFEADRSQDEEKPVVYGRSWKASELRLKSWDDLNKL 73 >XP_002320251.1 ribosomal protein L29 [Populus trichocarpa] ABK93723.1 unknown [Populus trichocarpa] EEE98566.1 ribosomal protein L29 [Populus trichocarpa] Length = 142 Score = 92.8 bits (229), Expect = 4e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAA+A + +NPLEEFFEADRS DEDKP+VYGRSWKASELRLKSWDDLQKL Sbjct: 25 AAATATSGHNPLEEFFEADRSQDEDKPIVYGRSWKASELRLKSWDDLQKL 74 >XP_002283452.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vitis vinifera] XP_002283459.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vitis vinifera] XP_010663204.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vitis vinifera] XP_010663205.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Vitis vinifera] CBI15073.3 unnamed protein product, partial [Vitis vinifera] Length = 140 Score = 92.0 bits (227), Expect = 7e-21 Identities = 43/49 (87%), Positives = 44/49 (89%) Frame = +1 Query: 4 AASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA+AR YNPLEEFFEADRS DEDKPVVYGR WKASELRLKSWDDL KL Sbjct: 24 AATARAGYNPLEEFFEADRSPDEDKPVVYGRGWKASELRLKSWDDLHKL 72 >XP_010111539.1 39S ribosomal protein L47 [Morus notabilis] EXC31172.1 39S ribosomal protein L47 [Morus notabilis] Length = 143 Score = 91.7 bits (226), Expect = 1e-20 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 A +S RT YNPLEEFFE DRS ++DKPVVYGRSWKASELRLKSWDDLQKL Sbjct: 26 ATSSVRTGYNPLEEFFEVDRSPEDDKPVVYGRSWKASELRLKSWDDLQKL 75 >CDP18073.1 unnamed protein product [Coffea canephora] Length = 146 Score = 91.7 bits (226), Expect = 1e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++ART +NPLE FFEADRS D+DKPVVYGR WKASELRLKSWDDLQKL Sbjct: 29 AASTARTKHNPLENFFEADRSPDDDKPVVYGRGWKASELRLKSWDDLQKL 78 >XP_010259749.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Nelumbo nucifera] XP_010259751.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Nelumbo nucifera] Length = 143 Score = 90.9 bits (224), Expect = 2e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AAASAR +NPL+EFFEADRS D+D+PVVYGRSWKASELRLKSWDDL KL Sbjct: 26 AAASARMVHNPLQEFFEADRSQDDDQPVVYGRSWKASELRLKSWDDLHKL 75 >XP_009397507.1 PREDICTED: 39S ribosomal protein L47, mitochondrial [Musa acuminata subsp. malaccensis] Length = 145 Score = 90.1 bits (222), Expect = 5e-20 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA SAR +NPLEEFFE DRS DE+KPVVYGR WKASELRLKSWDDLQKL Sbjct: 28 AADSARRAHNPLEEFFEVDRSTDEEKPVVYGRGWKASELRLKSWDDLQKL 77 Score = 53.1 bits (126), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 224 KHVLTERAIAEADPRRSAEMKRMINAL 304 KHVLTERAIAE DPRRSAEMKRMINAL Sbjct: 119 KHVLTERAIAEPDPRRSAEMKRMINAL 145 >JAU04797.1 39S ribosomal protein L47, mitochondrial [Noccaea caerulescens] JAU32182.1 39S ribosomal protein L47, mitochondrial [Noccaea caerulescens] JAU69553.1 39S ribosomal protein L47, mitochondrial [Noccaea caerulescens] Length = 143 Score = 89.4 bits (220), Expect = 9e-20 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++ RT NPLEEFFE DRS DEDKPVVYGR WKASELRLKSWDDLQKL Sbjct: 26 AASTVRTPNNPLEEFFEFDRSQDEDKPVVYGRGWKASELRLKSWDDLQKL 75 >XP_002889667.1 ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] EFH65926.1 ribosomal protein L29 family protein [Arabidopsis lyrata subsp. lyrata] Length = 143 Score = 89.4 bits (220), Expect = 9e-20 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++ RT NPLEEFFE DRS DEDKPVVYGR WKASELRLKSWDDLQKL Sbjct: 26 AASAIRTPQNPLEEFFEFDRSQDEDKPVVYGRGWKASELRLKSWDDLQKL 75 >XP_006292012.1 hypothetical protein CARUB_v10018201mg [Capsella rubella] XP_006292013.1 hypothetical protein CARUB_v10018201mg [Capsella rubella] EOA24910.1 hypothetical protein CARUB_v10018201mg [Capsella rubella] EOA24911.1 hypothetical protein CARUB_v10018201mg [Capsella rubella] Length = 144 Score = 89.4 bits (220), Expect = 9e-20 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++ RT NPLEEFFE DRS DEDKPVVYGR WKASELRLKSWDDLQKL Sbjct: 27 AASAIRTPQNPLEEFFEFDRSQDEDKPVVYGRGWKASELRLKSWDDLQKL 76 >XP_009118414.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica rapa] XP_009118415.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Brassica rapa] Length = 146 Score = 89.4 bits (220), Expect = 9e-20 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA++AR NPLEEFFE DRS DEDKPVVYGR WKASELRLKSWDDLQKL Sbjct: 29 AASTARVAKNPLEEFFEFDRSQDEDKPVVYGRGWKASELRLKSWDDLQKL 78 >XP_017255534.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Daucus carota subsp. sativus] XP_017255535.1 PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Daucus carota subsp. sativus] KZM91073.1 hypothetical protein DCAR_021562 [Daucus carota subsp. sativus] Length = 141 Score = 89.0 bits (219), Expect = 1e-19 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +1 Query: 1 AAASARTTYNPLEEFFEADRSADEDKPVVYGRSWKASELRLKSWDDLQKL 150 AA+ AR +NPLEEFFE DRS DEDKP+VYGRSWKASELRLKSWDDL KL Sbjct: 24 AASMARMGHNPLEEFFETDRSPDEDKPIVYGRSWKASELRLKSWDDLHKL 73