BLASTX nr result
ID: Magnolia22_contig00000215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000215 (535 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAB39475.1 putative IPP isomerase 1, partial [Cynanchum rostella... 62 2e-09 ABD59795.1 isopentenyl pyrophosphate:dimethyllallyl pyrophosphat... 62 3e-09 ABA01560.1 isopentenyl pyrophosphate isomerase, partial [Bupleur... 63 3e-09 ABY90138.1 isopentenyl pyrophosphate isomerase, partial [Bupleur... 63 3e-09 BAB39478.1 putative IPP isomerase, partial [Youngia japonica] 62 4e-09 BAB21062.1 putative IPP isomerase, partial [Sonchus oleraceus] 62 4e-09 BAB39471.1 putative IPP isomerase 2, partial [Sonchus oleraceus] 62 4e-09 ABR26078.1 isopentenyl pyrophosphate: dimethyllallyl pyrophospha... 63 4e-09 AID51443.1 isopentenyl diphosphate isomerase, partial [Astragalu... 63 6e-09 BAB16690.2 putative IPP isomerase [Eucommia ulmoides] 63 6e-09 APY22348.1 isopentenyl-diphosphate delta-isomerase, partial [Hed... 63 6e-09 XP_019153180.1 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 63 7e-09 O48964.1 RecName: Full=Isopentenyl-diphosphate Delta-isomerase I... 63 7e-09 BAC65421.1 isopentenyl-diphosphate delta-isomerase [Periploca se... 63 7e-09 AJG03074.1 IDI1 [Gentiana rigescens] AJG03075.1 IDI2 [Gentiana r... 63 7e-09 BAI47570.1 isopentenyl diphosphate isomerase [Ipomoea sp. Kenyan] 63 7e-09 NP_001234853.1 isopentenyl diphosphate isomerase [Solanum lycope... 63 7e-09 BAE92732.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] 63 7e-09 XP_004957946.2 PREDICTED: isopentenyl-diphosphate Delta-isomeras... 63 7e-09 XP_002460827.1 hypothetical protein SORBIDRAFT_02g035700 [Sorghu... 63 7e-09 >BAB39475.1 putative IPP isomerase 1, partial [Cynanchum rostellatum] Length = 119 Score = 62.0 bits (149), Expect = 2e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKY+LLLQ+ Sbjct: 14 HLMEKIESENLLHRAFSVFLFNSKYDLLLQQ 44 >ABD59795.1 isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase, partial [Arnebia euchroma] Length = 120 Score = 62.0 bits (149), Expect = 3e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIE+ENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 35 HLMEKIEAENLLHRAFSVFLFNSKYELLLQQ 65 >ABA01560.1 isopentenyl pyrophosphate isomerase, partial [Bupleurum falcatum] Length = 176 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 4 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 34 >ABY90138.1 isopentenyl pyrophosphate isomerase, partial [Bupleurum chinense] Length = 177 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 5 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 35 >BAB39478.1 putative IPP isomerase, partial [Youngia japonica] Length = 120 Score = 61.6 bits (148), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIE ENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 15 HLMEKIEKENLLHRAFSVFLFNSKYELLLQQ 45 >BAB21062.1 putative IPP isomerase, partial [Sonchus oleraceus] Length = 120 Score = 61.6 bits (148), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIE ENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 15 HLMEKIEKENLLHRAFSVFLFNSKYELLLQQ 45 >BAB39471.1 putative IPP isomerase 2, partial [Sonchus oleraceus] Length = 120 Score = 61.6 bits (148), Expect = 4e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIE ENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 15 HLMEKIEKENLLHRAFSVFLFNSKYELLLQQ 45 >ABR26078.1 isopentenyl pyrophosphate: dimethyllallyl pyrophosphate isomerase, partial [Oryza sativa Indica Group] Length = 201 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 8 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 38 >AID51443.1 isopentenyl diphosphate isomerase, partial [Astragalus membranaceus] Length = 223 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 30 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 60 >BAB16690.2 putative IPP isomerase [Eucommia ulmoides] Length = 224 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 25 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 55 >APY22348.1 isopentenyl-diphosphate delta-isomerase, partial [Hedera helix] Length = 226 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 33 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 63 >XP_019153180.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase I [Ipomoea nil] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >O48964.1 RecName: Full=Isopentenyl-diphosphate Delta-isomerase I; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I AAB94132.1 isopentenyl diphosphate isomerase I [Camptotheca acuminata] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >BAC65421.1 isopentenyl-diphosphate delta-isomerase [Periploca sepium] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >AJG03074.1 IDI1 [Gentiana rigescens] AJG03075.1 IDI2 [Gentiana rigescens] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >BAI47570.1 isopentenyl diphosphate isomerase [Ipomoea sp. Kenyan] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >NP_001234853.1 isopentenyl diphosphate isomerase [Solanum lycopersicum] XP_015074542.1 PREDICTED: isopentenyl-diphosphate Delta-isomerase II [Solanum pennellii] ABX55779.1 isopentenyl diphosphate isomerase [Solanum lycopersicum] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >BAE92732.1 isopentenyl pyrophosphate isomerase [Gentiana lutea] Length = 235 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 72 >XP_004957946.2 PREDICTED: isopentenyl-diphosphate Delta-isomerase I isoform X2 [Setaria italica] KQL26143.1 hypothetical protein SETIT_030981mg [Setaria italica] Length = 237 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 43 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 73 >XP_002460827.1 hypothetical protein SORBIDRAFT_02g035700 [Sorghum bicolor] EER97348.1 hypothetical protein SORBI_002G330500 [Sorghum bicolor] Length = 237 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 533 HLMEKIESENLLHRAFSVFLFNSKYELLLQE 441 HLMEKIESENLLHRAFSVFLFNSKYELLLQ+ Sbjct: 43 HLMEKIESENLLHRAFSVFLFNSKYELLLQQ 73