BLASTX nr result
ID: Magnolia22_contig00000193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000193 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006849679.1 PREDICTED: uncharacterized protein LOC18439452 [A... 54 1e-05 >XP_006849679.1 PREDICTED: uncharacterized protein LOC18439452 [Amborella trichopoda] ERN11260.1 hypothetical protein AMTR_s00024p00234750 [Amborella trichopoda] Length = 246 Score = 53.5 bits (127), Expect = 1e-05 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -3 Query: 429 EDQEPWLPLPPGPHLRSSLSTPAPQWSISARSFSLTDLQSASSTSSISPRDRQKKF 262 +D EP LP P P L+S + P+WS +RSFSLTDLQ A+ S +SP +R KKF Sbjct: 193 DDHEPKLP-PLHPRLKSHSNFSPPEWSFPSRSFSLTDLQGAN--SPVSPEERYKKF 245