BLASTX nr result
ID: Magnolia22_contig00000082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000082 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015889056.1 PREDICTED: 40S ribosomal protein S29-like [Ziziph... 60 1e-09 XP_009405891.2 PREDICTED: 40S ribosomal protein S29 [Musa acumin... 57 2e-08 XP_016177446.1 PREDICTED: 40S ribosomal protein S29-like [Arachi... 56 2e-08 XP_015938948.1 PREDICTED: 40S ribosomal protein S29-like [Arachi... 56 2e-08 KQK95511.1 hypothetical protein SETIT_027047mg [Setaria italica] 57 4e-08 OIV91134.1 hypothetical protein TanjilG_30356 [Lupinus angustifo... 55 6e-08 XP_015942136.1 PREDICTED: 40S ribosomal protein S29 [Arachis dur... 55 6e-08 XP_015892836.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus ju... 55 6e-08 XP_015892835.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus ju... 55 6e-08 KGN52774.1 hypothetical protein Csa_4G000930 [Cucumis sativus] 55 6e-08 XP_002271801.1 PREDICTED: 40S ribosomal protein S29 [Vitis vinif... 55 6e-08 XP_007223556.1 hypothetical protein PRUPE_ppa014535mg [Prunus pe... 55 6e-08 OAY51010.1 hypothetical protein MANES_05G180600 [Manihot esculenta] 55 6e-08 XP_002313420.2 hypothetical protein POPTR_0009s09320g [Populus t... 55 6e-08 XP_011078121.1 PREDICTED: 40S ribosomal protein S29 [Sesamum ind... 55 9e-08 ABK93131.1 unknown [Populus trichocarpa] 55 9e-08 CBI27789.3 unnamed protein product, partial [Vitis vinifera] 55 9e-08 GAV64779.1 Ribosomal_S14 domain-containing protein [Cephalotus f... 55 1e-07 XP_002298768.2 hypothetical protein POPTR_0001s30310g [Populus t... 55 1e-07 BAU00845.1 hypothetical protein VIGAN_10248000 [Vigna angularis ... 55 1e-07 >XP_015889056.1 PREDICTED: 40S ribosomal protein S29-like [Ziziphus jujuba] Length = 92 Score = 60.5 bits (145), Expect = 1e-09 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +3 Query: 96 EERKMGHTNVWNSHPKNYGPGSRTCR 173 ++RKMGH+NVWNSHPKNYGPGSRTCR Sbjct: 33 QQRKMGHSNVWNSHPKNYGPGSRTCR 58 >XP_009405891.2 PREDICTED: 40S ribosomal protein S29 [Musa acuminata subsp. malaccensis] Length = 88 Score = 57.4 bits (137), Expect = 2e-08 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +3 Query: 96 EERKMGHTNVWNSHPKNYGPGSRTCR 173 E R+MGH+NVWNSHPKNYGPGSR CR Sbjct: 29 ERREMGHSNVWNSHPKNYGPGSRVCR 54 >XP_016177446.1 PREDICTED: 40S ribosomal protein S29-like [Arachis ipaensis] Length = 56 Score = 56.2 bits (134), Expect = 2e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGHTN+WNSHPKNYGPGSRTCR Sbjct: 1 MGHTNIWNSHPKNYGPGSRTCR 22 >XP_015938948.1 PREDICTED: 40S ribosomal protein S29-like [Arachis duranensis] Length = 56 Score = 56.2 bits (134), Expect = 2e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGHTN+WNSHPKNYGPGSRTCR Sbjct: 1 MGHTNIWNSHPKNYGPGSRTCR 22 >KQK95511.1 hypothetical protein SETIT_027047mg [Setaria italica] Length = 110 Score = 57.0 bits (136), Expect = 4e-08 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 81 KTRVFEERKMGHTNVWNSHPKNYGPGSRTCR 173 K R E+ +MGH+NVWNSHPKNYGPGSR CR Sbjct: 46 KRRRKEQAEMGHSNVWNSHPKNYGPGSRVCR 76 >OIV91134.1 hypothetical protein TanjilG_30356 [Lupinus angustifolius] OIW06881.1 hypothetical protein TanjilG_19530 [Lupinus angustifolius] OIW12866.1 hypothetical protein TanjilG_24799 [Lupinus angustifolius] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_015942136.1 PREDICTED: 40S ribosomal protein S29 [Arachis duranensis] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_015892836.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] XP_015866898.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_015892835.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] XP_015866899.1 PREDICTED: 40S ribosomal protein S29 [Ziziphus jujuba] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >KGN52774.1 hypothetical protein Csa_4G000930 [Cucumis sativus] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_002271801.1 PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] XP_002277856.1 PREDICTED: 40S ribosomal protein S29 [Vitis vinifera] XP_002510113.1 PREDICTED: 40S ribosomal protein S29 [Ricinus communis] XP_003517600.1 PREDICTED: 40S ribosomal protein S29 [Glycine max] XP_003536587.1 PREDICTED: 40S ribosomal protein S29 [Glycine max] XP_003537955.1 PREDICTED: 40S ribosomal protein S29 [Glycine max] XP_003555985.1 PREDICTED: 40S ribosomal protein S29 [Glycine max] XP_004136942.1 PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] XP_004141284.1 PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] XP_004152273.1 PREDICTED: 40S ribosomal protein S29 [Cucumis sativus] XP_008236441.1 PREDICTED: 40S ribosomal protein S29 [Prunus mume] XP_008373047.1 PREDICTED: 40S ribosomal protein S29 [Malus domestica] XP_008366503.1 PREDICTED: 40S ribosomal protein S29 [Malus domestica] XP_008452633.1 PREDICTED: 40S ribosomal protein S29 [Cucumis melo] XP_008454386.1 PREDICTED: 40S ribosomal protein S29 [Cucumis melo] XP_008455027.1 PREDICTED: 40S ribosomal protein S29 [Cucumis melo] XP_009335389.1 PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] XP_009335391.1 PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] XP_009335395.1 PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] XP_009335396.1 PREDICTED: 40S ribosomal protein S29 [Pyrus x bretschneideri] XP_012068241.1 PREDICTED: 40S ribosomal protein S29-like [Jatropha curcas] XP_014512686.1 PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] XP_014520214.1 PREDICTED: 40S ribosomal protein S29 [Vigna radiata var. radiata] XP_015579872.1 PREDICTED: 40S ribosomal protein S29 [Ricinus communis] XP_016177041.1 PREDICTED: 40S ribosomal protein S29 [Arachis ipaensis] XP_017406681.1 PREDICTED: 40S ribosomal protein S29 [Vigna angularis] XP_017413940.1 PREDICTED: 40S ribosomal protein S29 [Vigna angularis] EEF52300.1 40S ribosomal protein S29, putative [Ricinus communis] KGN55257.1 40S ribosomal protein S29 [Cucumis sativus] KHN06796.1 40S ribosomal protein S29 [Glycine soja] KHN42324.1 40S ribosomal protein S29 [Glycine soja] OIW07926.1 hypothetical protein TanjilG_20027 [Lupinus angustifolius] ONH91889.1 hypothetical protein PRUPE_8G141900 [Prunus persica] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_007223556.1 hypothetical protein PRUPE_ppa014535mg [Prunus persica] XP_008220312.1 PREDICTED: 40S ribosomal protein S29-like [Prunus mume] XP_008377973.1 PREDICTED: 40S ribosomal protein S29-like [Malus domestica] XP_008377975.1 PREDICTED: 40S ribosomal protein S29-like [Malus domestica] XP_008393747.1 PREDICTED: 40S ribosomal protein S29-like [Malus domestica] XP_009360488.1 PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] XP_009354108.1 PREDICTED: 40S ribosomal protein S29-like [Pyrus x bretschneideri] ONI33449.1 hypothetical protein PRUPE_1G424800 [Prunus persica] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >OAY51010.1 hypothetical protein MANES_05G180600 [Manihot esculenta] Length = 57 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_002313420.2 hypothetical protein POPTR_0009s09320g [Populus trichocarpa] EEE87375.2 hypothetical protein POPTR_0009s09320g [Populus trichocarpa] Length = 57 Score = 55.1 bits (131), Expect = 6e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_011078121.1 PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] XP_011088056.1 PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] XP_011092516.1 PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] XP_011093855.1 PREDICTED: 40S ribosomal protein S29 [Sesamum indicum] Length = 56 Score = 54.7 bits (130), Expect = 9e-08 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+N+WNSHPKNYGPGSRTCR Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCR 22 >ABK93131.1 unknown [Populus trichocarpa] Length = 56 Score = 54.7 bits (130), Expect = 9e-08 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+N+WNSHPKNYGPGSRTCR Sbjct: 1 MGHSNIWNSHPKNYGPGSRTCR 22 >CBI27789.3 unnamed protein product, partial [Vitis vinifera] Length = 73 Score = 55.1 bits (131), Expect = 9e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >GAV64779.1 Ribosomal_S14 domain-containing protein [Cephalotus follicularis] Length = 74 Score = 55.1 bits (131), Expect = 1e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >XP_002298768.2 hypothetical protein POPTR_0001s30310g [Populus trichocarpa] EEE83573.2 hypothetical protein POPTR_0001s30310g [Populus trichocarpa] Length = 80 Score = 55.1 bits (131), Expect = 1e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22 >BAU00845.1 hypothetical protein VIGAN_10248000 [Vigna angularis var. angularis] Length = 87 Score = 55.1 bits (131), Expect = 1e-07 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 108 MGHTNVWNSHPKNYGPGSRTCR 173 MGH+NVWNSHPKNYGPGSRTCR Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCR 22