BLASTX nr result
ID: Lithospermum23_contig00051572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00051572 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM49534.1 hypothetical protein LR48_Vigan08g036100 [Vigna angul... 55 2e-06 EPS67601.1 trehalose-phosphate synthase 1 [Genlisea aurea] 54 2e-06 KJB61506.1 hypothetical protein B456_009G362600 [Gossypium raimo... 54 3e-06 KJB61505.1 hypothetical protein B456_009G362600 [Gossypium raimo... 54 3e-06 XP_012441171.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_016685791.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_012441170.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 NP_001234879.1 trehalose-phosphate synthase 1 [Solanum lycopersi... 54 3e-06 XP_015081912.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_008463784.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_006348332.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 ADO16162.1 trehalose-6-phosphate synthase [Petunia x hybrida] 54 3e-06 XP_019237652.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_016490922.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_009776321.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_009590246.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 NP_001312790.1 alpha,alpha-trehalose-phosphate synthase [UDP-for... 54 3e-06 XP_004146015.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_016581086.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 XP_016685790.1 PREDICTED: alpha,alpha-trehalose-phosphate syntha... 54 3e-06 >KOM49534.1 hypothetical protein LR48_Vigan08g036100 [Vigna angularis] Length = 413 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELL 82 +PYWR+KVVLLQIAVPTRTDVPEC LL Sbjct: 386 DPYWRDKVVLLQIAVPTRTDVPECMLL 412 >EPS67601.1 trehalose-phosphate synthase 1 [Genlisea aurea] Length = 411 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPEC 73 NPYWR+KVVLLQIAVPTRTDVPEC Sbjct: 383 NPYWRDKVVLLQIAVPTRTDVPEC 406 >KJB61506.1 hypothetical protein B456_009G362600 [Gossypium raimondii] Length = 689 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 351 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 385 >KJB61505.1 hypothetical protein B456_009G362600 [Gossypium raimondii] Length = 907 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 351 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 385 >XP_012441171.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X5 [Gossypium raimondii] Length = 911 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 347 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 381 >XP_016685791.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X4 [Gossypium hirsutum] Length = 915 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 351 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 385 >XP_012441170.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X4 [Gossypium raimondii] KJB61504.1 hypothetical protein B456_009G362600 [Gossypium raimondii] Length = 915 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 351 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 385 >NP_001234879.1 trehalose-phosphate synthase 1 [Solanum lycopersicum] XP_010324173.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324174.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324175.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324176.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324177.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324178.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] XP_010324180.1 PREDICTED: trehalose-phosphate synthase 1 isoform X1 [Solanum lycopersicum] ABO61742.1 trehalose-phosphate synthase 1 [Solanum lycopersicum] Length = 926 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_015081912.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Solanum pennellii] XP_015081913.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Solanum pennellii] Length = 926 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_008463784.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Cucumis melo] XP_008463786.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Cucumis melo] XP_008463787.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Cucumis melo] Length = 926 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 392 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 426 >XP_006348332.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Solanum tuberosum] XP_006348333.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Solanum tuberosum] XP_006348334.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Solanum tuberosum] Length = 926 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >ADO16162.1 trehalose-6-phosphate synthase [Petunia x hybrida] Length = 927 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 390 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 424 >XP_019237652.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana attenuata] XP_019237653.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana attenuata] XP_019237654.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana attenuata] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_016490922.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Nicotiana tabacum] XP_016490923.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Nicotiana tabacum] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_009776321.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana sylvestris] XP_009776330.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana sylvestris] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_009590246.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana tomentosiformis] XP_009590250.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana tomentosiformis] XP_009590257.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 [Nicotiana tomentosiformis] XP_016489608.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Nicotiana tabacum] XP_016489610.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Nicotiana tabacum] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >NP_001312790.1 alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Nicotiana tabacum] BAI99252.1 trehalose 6-phosphate synthase [Nicotiana tabacum] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_004146015.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Cucumis sativus] XP_011654027.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like [Cucumis sativus] KGN55029.1 hypothetical protein Csa_4G622880 [Cucumis sativus] Length = 928 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 392 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 426 >XP_016581086.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] XP_016581087.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] XP_016581088.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] XP_016581089.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] XP_016581090.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] XP_016581091.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 isoform X3 [Capsicum annuum] Length = 930 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 389 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 423 >XP_016685790.1 PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1-like isoform X3 [Gossypium hirsutum] Length = 937 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +2 Query: 2 NPYWREKVVLLQIAVPTRTDVPECELLNSSQFQLL 106 NPYWR+KVVLLQIAVPTRTDVPE + L S +++ Sbjct: 381 NPYWRDKVVLLQIAVPTRTDVPEYQKLTSQVHEIV 415