BLASTX nr result
ID: Lithospermum23_contig00051467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00051467 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006453339.1 hypothetical protein CICLE_v10009829mg [Citrus cl... 53 2e-06 XP_011069936.1 PREDICTED: uncharacterized protein LOC105155712 [... 51 3e-06 XP_007225870.1 hypothetical protein PRUPE_ppa013528mg [Prunus pe... 52 4e-06 XP_019256183.1 PREDICTED: classical arabinogalactan protein 9 [N... 52 5e-06 XP_019177790.1 PREDICTED: pollen-specific leucine-rich repeat ex... 52 7e-06 XP_010526351.1 PREDICTED: uncharacterized protein LOC104803943 i... 51 7e-06 XP_009615474.1 PREDICTED: proline-rich extensin-like protein EPR... 52 7e-06 KZM92508.1 hypothetical protein DCAR_020127 [Daucus carota subsp... 51 9e-06 XP_010526349.1 PREDICTED: uncharacterized protein LOC104803943 i... 51 1e-05 >XP_006453339.1 hypothetical protein CICLE_v10009829mg [Citrus clementina] ESR66579.1 hypothetical protein CICLE_v10009829mg [Citrus clementina] Length = 143 Score = 52.8 bits (125), Expect = 2e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -3 Query: 321 WFGLDQSKYQWALDEYYESKGTVSTI 244 WFGL+QSKYQWALD+YYESKG VS I Sbjct: 101 WFGLNQSKYQWALDDYYESKGLVSLI 126 >XP_011069936.1 PREDICTED: uncharacterized protein LOC105155712 [Sesamum indicum] Length = 77 Score = 50.8 bits (120), Expect = 3e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = -3 Query: 324 YWFGLDQSKYQWALDEYYESKGTVSTIPRPLYRKS 220 +WFGL+QSKYQWALD+YYES G T +P + S Sbjct: 38 HWFGLNQSKYQWALDDYYESNGKNQTEAKPQVKPS 72 >XP_007225870.1 hypothetical protein PRUPE_ppa013528mg [Prunus persica] Length = 118 Score = 51.6 bits (122), Expect = 4e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -3 Query: 321 WFGLDQSKYQWALDEYYESKGTVS 250 WFGL+QSKYQWALD+YYESKG VS Sbjct: 94 WFGLNQSKYQWALDDYYESKGLVS 117 >XP_019256183.1 PREDICTED: classical arabinogalactan protein 9 [Nicotiana attenuata] OIS97323.1 hypothetical protein A4A49_37106 [Nicotiana attenuata] Length = 153 Score = 52.0 bits (123), Expect = 5e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 324 YWFGLDQSKYQWALDEYYESKGTVST 247 YWFGL+QSKYQWALD+YYESKG T Sbjct: 114 YWFGLNQSKYQWALDDYYESKGINQT 139 >XP_019177790.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 4 [Ipomoea nil] XP_019177791.1 PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 4 [Ipomoea nil] Length = 148 Score = 51.6 bits (122), Expect = 7e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = -3 Query: 324 YWFGLDQSKYQWALDEYYESKG 259 YWFGL+QSKYQWALD+YYESKG Sbjct: 109 YWFGLNQSKYQWALDDYYESKG 130 >XP_010526351.1 PREDICTED: uncharacterized protein LOC104803943 isoform X2 [Tarenaya hassleriana] Length = 114 Score = 50.8 bits (120), Expect = 7e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 321 WFGLDQSKYQWALDEYYESKG 259 WFGLDQSKYQWALDEYYE+KG Sbjct: 76 WFGLDQSKYQWALDEYYETKG 96 >XP_009615474.1 PREDICTED: proline-rich extensin-like protein EPR1 [Nicotiana tomentosiformis] Length = 153 Score = 51.6 bits (122), Expect = 7e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = -3 Query: 324 YWFGLDQSKYQWALDEYYESKG 259 YWFGL+QSKYQWALD+YYESKG Sbjct: 114 YWFGLNQSKYQWALDDYYESKG 135 >KZM92508.1 hypothetical protein DCAR_020127 [Daucus carota subsp. sativus] Length = 147 Score = 51.2 bits (121), Expect = 9e-06 Identities = 23/31 (74%), Positives = 26/31 (83%), Gaps = 3/31 (9%) Frame = -3 Query: 324 YWFGLDQSKYQWALDEYYESKGTV---STIP 241 +WFGL+QSKYQWALD+YYESKG V ST P Sbjct: 111 HWFGLNQSKYQWALDDYYESKGGVVCGSTFP 141 >XP_010526349.1 PREDICTED: uncharacterized protein LOC104803943 isoform X1 [Tarenaya hassleriana] Length = 131 Score = 50.8 bits (120), Expect = 1e-05 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 321 WFGLDQSKYQWALDEYYESKG 259 WFGLDQSKYQWALDEYYE+KG Sbjct: 93 WFGLDQSKYQWALDEYYETKG 113