BLASTX nr result
ID: Lithospermum23_contig00051317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00051317 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017970631.1 PREDICTED: vinorine synthase-like [Theobroma cacao] 64 3e-10 XP_015572147.1 PREDICTED: vinorine synthase [Ricinus communis] 64 6e-10 EEF47534.1 Anthranilate N-benzoyltransferase protein, putative [... 64 6e-10 XP_018806311.1 PREDICTED: vinorine synthase-like [Juglans regia] 62 2e-09 XP_007227141.1 hypothetical protein PRUPE_ppa026262mg [Prunus pe... 62 2e-09 XP_004310024.1 PREDICTED: vinorine synthase-like [Fragaria vesca... 61 4e-09 XP_018813121.1 PREDICTED: vinorine synthase-like [Juglans regia] 61 4e-09 XP_008360122.1 PREDICTED: vinorine synthase-like [Malus domestica] 61 6e-09 XP_002514981.1 PREDICTED: vinorine synthase [Ricinus communis] E... 61 6e-09 XP_011042323.1 PREDICTED: vinorine synthase-like [Populus euphra... 60 8e-09 KCW86595.1 hypothetical protein EUGRSUZ_B03227 [Eucalyptus grandis] 60 1e-08 XP_010044505.1 PREDICTED: vinorine synthase [Eucalyptus grandis] 60 1e-08 XP_002315640.2 hypothetical protein POPTR_0010s06380g [Populus t... 59 2e-08 KCW86594.1 hypothetical protein EUGRSUZ_B03226 [Eucalyptus grandis] 59 2e-08 XP_015894441.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] 59 2e-08 XP_015894443.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] 59 3e-08 OAY32384.1 hypothetical protein MANES_13G013800 [Manihot esculenta] 59 4e-08 XP_002267341.1 PREDICTED: vinorine synthase [Vitis vinifera] CBI... 59 4e-08 XP_009342768.1 PREDICTED: vinorine synthase-like [Pyrus x bretsc... 59 4e-08 XP_015894444.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] 58 7e-08 >XP_017970631.1 PREDICTED: vinorine synthase-like [Theobroma cacao] Length = 431 Score = 64.3 bits (155), Expect = 3e-10 Identities = 25/47 (53%), Positives = 38/47 (80%) Frame = +3 Query: 114 SLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 ++ ++LS++++ PSSPTP HLRHY L FLDQ++ P F+P+ +FYPK Sbjct: 2 NIDIEVLSQEMIKPSSPTPDHLRHYQLSFLDQIQPPIFMPLVMFYPK 48 >XP_015572147.1 PREDICTED: vinorine synthase [Ricinus communis] Length = 431 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 MD +K ++S++L+ PSSPTPH LRHY L FLDQ+ P F+P+ LFYPK Sbjct: 1 MDEVK--VISKELIKPSSPTPHLLRHYQLSFLDQIAVPVFMPLVLFYPK 47 >EEF47534.1 Anthranilate N-benzoyltransferase protein, putative [Ricinus communis] Length = 450 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 MD +K ++S++L+ PSSPTPH LRHY L FLDQ+ P F+P+ LFYPK Sbjct: 1 MDEVK--VISKELIKPSSPTPHLLRHYQLSFLDQIAVPVFMPLVLFYPK 47 >XP_018806311.1 PREDICTED: vinorine synthase-like [Juglans regia] Length = 444 Score = 62.0 bits (149), Expect = 2e-09 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 M +L Q++SE+ + PSSPTP HLRHY L FLDQ+ P F+P+ LF+P Sbjct: 1 MKALVIQVISEESIKPSSPTPPHLRHYQLSFLDQIAPPVFMPLVLFFP 48 >XP_007227141.1 hypothetical protein PRUPE_ppa026262mg [Prunus persica] ONI30199.1 hypothetical protein PRUPE_1G237200 [Prunus persica] Length = 457 Score = 62.0 bits (149), Expect = 2e-09 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M +L+ ++LS + V PSSPTP HLR +NL F+DQL P F+PM LF+PK Sbjct: 1 MPALEIEVLSTETVKPSSPTPPHLRRHNLSFIDQLNPPVFMPMVLFFPK 49 >XP_004310024.1 PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca] Length = 447 Score = 61.2 bits (147), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +3 Query: 117 LKFQL--LSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 +KFQ+ LS + + PSSPTP HLRH+ L +LDQ++ P F+PM LFYPK Sbjct: 1 MKFQVEVLSTETIKPSSPTPDHLRHHKLSYLDQIQPPIFMPMVLFYPK 48 >XP_018813121.1 PREDICTED: vinorine synthase-like [Juglans regia] Length = 462 Score = 61.2 bits (147), Expect = 4e-09 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 105 IMDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 I+ L Q++SE+ + PSSPTP HLRHY L FLDQ+ P F+P+ LF+P Sbjct: 17 IISHLLIQVISEENIKPSSPTPPHLRHYQLSFLDQIAPPVFMPLVLFFP 65 >XP_008360122.1 PREDICTED: vinorine synthase-like [Malus domestica] Length = 370 Score = 60.8 bits (146), Expect = 6e-09 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M L+ +++S + + PSSPTP HLR +NL FLDQ++ P F+PM LF+PK Sbjct: 1 MTKLEVEVVSTETIKPSSPTPDHLRRHNLSFLDQIQPPIFMPMVLFFPK 49 >XP_002514981.1 PREDICTED: vinorine synthase [Ricinus communis] EEF47535.1 Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis] Length = 430 Score = 60.8 bits (146), Expect = 6e-09 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +3 Query: 117 LKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 L+ +++SE+++ PSSPTP HLRHY L FLDQ+ P + P+ LFYP Sbjct: 3 LEIEVISEEIIKPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYP 47 >XP_011042323.1 PREDICTED: vinorine synthase-like [Populus euphratica] Length = 430 Score = 60.5 bits (145), Expect = 8e-09 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +3 Query: 117 LKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 ++ +++S +++ PSSPTP HLRHY L FLDQ+ P + PM LFYP Sbjct: 3 IEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPMLLFYP 47 >KCW86595.1 hypothetical protein EUGRSUZ_B03227 [Eucalyptus grandis] Length = 443 Score = 60.1 bits (144), Expect = 1e-08 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M ++ +++S + PSSPTP HLRHY L FLDQ++ P F+P+ LF+P+ Sbjct: 1 MADVEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFFPR 49 >XP_010044505.1 PREDICTED: vinorine synthase [Eucalyptus grandis] Length = 445 Score = 60.1 bits (144), Expect = 1e-08 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M ++ +++S + PSSPTP HLRHY L FLDQ++ P F+P+ LF+P+ Sbjct: 3 MADVEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFFPR 51 >XP_002315640.2 hypothetical protein POPTR_0010s06380g [Populus trichocarpa] EEF01811.2 hypothetical protein POPTR_0010s06380g [Populus trichocarpa] Length = 394 Score = 59.3 bits (142), Expect = 2e-08 Identities = 23/45 (51%), Positives = 34/45 (75%) Frame = +3 Query: 117 LKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 ++ +++S +++ PSSPTP HLRHY L FLDQ+ P + P+ LFYP Sbjct: 3 IEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPLLLFYP 47 >KCW86594.1 hypothetical protein EUGRSUZ_B03226 [Eucalyptus grandis] Length = 412 Score = 59.3 bits (142), Expect = 2e-08 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = +3 Query: 117 LKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 ++ +++S +V PSSPTP HLRHY L FLDQ++ P F+P LF+P+ Sbjct: 6 VEVEVISSDIVKPSSPTPDHLRHYKLSFLDQIQVPVFMPWILFFPR 51 >XP_015894441.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] Length = 417 Score = 59.3 bits (142), Expect = 2e-08 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M ++ Q++S++ + PS+ TP HLRHY+L FLDQ+E F+PM FYPK Sbjct: 1 MKNIDIQVISKQSIKPSASTPDHLRHYHLSFLDQIEPTIFIPMIFFYPK 49 >XP_015894443.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] Length = 588 Score = 58.9 bits (141), Expect = 3e-08 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M ++ Q++S++ + PS+PTP HLRHY L FLDQ+ F+PM FYPK Sbjct: 1 MKNIDIQVISKQSIKPSAPTPDHLRHYQLSFLDQIAPTVFMPMIFFYPK 49 >OAY32384.1 hypothetical protein MANES_13G013800 [Manihot esculenta] Length = 426 Score = 58.5 bits (140), Expect = 4e-08 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 117 LKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 L+ +++SE+++ PSSPTP HL HYNL FLDQ+ P + P L YP Sbjct: 3 LEIEIISEEIIKPSSPTPDHLHHYNLSFLDQISPPVYNPFILLYP 47 >XP_002267341.1 PREDICTED: vinorine synthase [Vitis vinifera] CBI27536.3 unnamed protein product, partial [Vitis vinifera] Length = 431 Score = 58.5 bits (140), Expect = 4e-08 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYP 251 M+ ++ +++S + PSSPTP HLRH+ L FLDQ+ P F+P+ LFYP Sbjct: 1 MEEIEVEVISTDTIKPSSPTPAHLRHFQLSFLDQVLSPIFIPIILFYP 48 >XP_009342768.1 PREDICTED: vinorine synthase-like [Pyrus x bretschneideri] Length = 444 Score = 58.5 bits (140), Expect = 4e-08 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M L+ +++S + + PSSPTP HLR + L FLDQ++ P F+PM LF+PK Sbjct: 1 MTKLEVEVVSTETIKPSSPTPDHLRRHKLSFLDQIQPPIFMPMVLFFPK 49 >XP_015894444.1 PREDICTED: vinorine synthase-like [Ziziphus jujuba] Length = 354 Score = 57.8 bits (138), Expect = 7e-08 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +3 Query: 108 MDSLKFQLLSEKLVIPSSPTPHHLRHYNLCFLDQLECPNFVPMTLFYPK 254 M ++ Q++S++ + PS+PTP HLRHY L FLD + F+PM FYPK Sbjct: 1 MKNIDIQVISKQSIKPSAPTPDHLRHYQLSFLDPIAPSTFMPMIFFYPK 49