BLASTX nr result
ID: Lithospermum23_contig00051032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00051032 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010656089.1 PREDICTED: respiratory burst oxidase homolog prot... 67 9e-11 XP_002277540.1 PREDICTED: respiratory burst oxidase homolog prot... 67 9e-11 XP_009343364.1 PREDICTED: respiratory burst oxidase homolog prot... 66 2e-10 XP_018820783.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_016651947.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_015572971.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_008242282.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_008337815.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_018820782.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_017178834.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 XP_002516222.1 PREDICTED: respiratory burst oxidase homolog prot... 65 3e-10 ONH97500.1 hypothetical protein PRUPE_7G193000 [Prunus persica] ... 65 6e-10 XP_007203796.1 hypothetical protein PRUPE_ppa001114mg [Prunus pe... 65 6e-10 XP_019415830.1 PREDICTED: respiratory burst oxidase homolog prot... 65 6e-10 XP_016578858.1 PREDICTED: respiratory burst oxidase homolog prot... 64 8e-10 XP_015871806.1 PREDICTED: respiratory burst oxidase homolog prot... 64 8e-10 XP_016580076.1 PREDICTED: respiratory burst oxidase homolog prot... 64 8e-10 CDP03040.1 unnamed protein product [Coffea canephora] 64 8e-10 XP_009799189.1 PREDICTED: respiratory burst oxidase homolog prot... 64 8e-10 XP_015867690.1 PREDICTED: respiratory burst oxidase homolog prot... 64 8e-10 >XP_010656089.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Vitis vinifera] Length = 893 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLLSSLI 126 TW YI VP LLYVAERSLRTCRSEHYSVKILKV +L + Sbjct: 567 TWMYISVPFLLYVAERSLRTCRSEHYSVKILKVSVLPGAV 606 >XP_002277540.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Vitis vinifera] CBI27762.3 unnamed protein product, partial [Vitis vinifera] Length = 917 Score = 67.0 bits (162), Expect = 9e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLLSSLI 126 TW YI VP LLYVAERSLRTCRSEHYSVKILKV +L + Sbjct: 567 TWMYISVPFLLYVAERSLRTCRSEHYSVKILKVSVLPGAV 606 >XP_009343364.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Pyrus x bretschneideri] Length = 915 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAERSLRTCRS+HYSVK+LKV +L Sbjct: 568 TWMYISVPLLLYVAERSLRTCRSKHYSVKMLKVSIL 603 >XP_018820783.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Juglans regia] Length = 902 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAER++RTCRSEHYSVK+LKV +L Sbjct: 579 TWMYISVPLLLYVAERTVRTCRSEHYSVKVLKVSVL 614 >XP_016651947.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Prunus mume] Length = 905 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRS+HYSVKILKV +L Sbjct: 564 TWMYISVPLLLYIAERSVRTCRSQHYSVKILKVSVL 599 >XP_015572971.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Ricinus communis] Length = 910 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI PLLLYVAERS+RTCRSEHYSVKILKV +L Sbjct: 585 TWLYISAPLLLYVAERSVRTCRSEHYSVKILKVSVL 620 >XP_008242282.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Prunus mume] Length = 912 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRS+HYSVKILKV +L Sbjct: 564 TWMYISVPLLLYIAERSVRTCRSQHYSVKILKVSVL 599 >XP_008337815.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X2 [Malus domestica] Length = 917 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAERSLRTCRS+HYSVK+LKV +L Sbjct: 569 TWMYISVPLLLYVAERSLRTCRSKHYSVKMLKVSVL 604 >XP_018820782.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Juglans regia] Length = 926 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAER++RTCRSEHYSVK+LKV +L Sbjct: 579 TWMYISVPLLLYVAERTVRTCRSEHYSVKVLKVSVL 614 >XP_017178834.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Malus domestica] Length = 933 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAERSLRTCRS+HYSVK+LKV +L Sbjct: 569 TWMYISVPLLLYVAERSLRTCRSKHYSVKMLKVSVL 604 >XP_002516222.1 PREDICTED: respiratory burst oxidase homolog protein E isoform X1 [Ricinus communis] EEF46224.1 respiratory burst oxidase, putative [Ricinus communis] Length = 934 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI PLLLYVAERS+RTCRSEHYSVKILKV +L Sbjct: 585 TWLYISAPLLLYVAERSVRTCRSEHYSVKILKVSVL 620 >ONH97500.1 hypothetical protein PRUPE_7G193000 [Prunus persica] ONH97501.1 hypothetical protein PRUPE_7G193000 [Prunus persica] ONH97502.1 hypothetical protein PRUPE_7G193000 [Prunus persica] Length = 655 Score = 64.7 bits (156), Expect = 6e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRS+HYSVKILKV +L Sbjct: 307 TWMYISVPLLLYIAERSVRTCRSQHYSVKILKVLVL 342 >XP_007203796.1 hypothetical protein PRUPE_ppa001114mg [Prunus persica] ONH97499.1 hypothetical protein PRUPE_7G193000 [Prunus persica] Length = 906 Score = 64.7 bits (156), Expect = 6e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRS+HYSVKILKV +L Sbjct: 558 TWMYISVPLLLYIAERSVRTCRSQHYSVKILKVLVL 593 >XP_019415830.1 PREDICTED: respiratory burst oxidase homolog protein E [Lupinus angustifolius] OIV98345.1 hypothetical protein TanjilG_16672 [Lupinus angustifolius] Length = 922 Score = 64.7 bits (156), Expect = 6e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI +PLLLYV ER+LRTCRSEHYSVK+LKV +L Sbjct: 575 TWMYISIPLLLYVGERALRTCRSEHYSVKVLKVSVL 610 >XP_016578858.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Capsicum annuum] Length = 623 Score = 64.3 bits (155), Expect = 8e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI +PLLLYVAERSLRTCRSEHY+ KILKV +L Sbjct: 277 TWMYISMPLLLYVAERSLRTCRSEHYAAKILKVSVL 312 >XP_015871806.1 PREDICTED: respiratory burst oxidase homolog protein E-like, partial [Ziziphus jujuba] Length = 627 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRSEHY+VKI+KV +L Sbjct: 281 TWMYISVPLLLYMAERSIRTCRSEHYAVKIIKVSVL 316 >XP_016580076.1 PREDICTED: respiratory burst oxidase homolog protein E-like [Capsicum annuum] Length = 883 Score = 64.3 bits (155), Expect = 8e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI +PLLLYVAERSLRTCRSEHY+ KILKV +L Sbjct: 598 TWMYISMPLLLYVAERSLRTCRSEHYAAKILKVSVL 633 >CDP03040.1 unnamed protein product [Coffea canephora] Length = 924 Score = 64.3 bits (155), Expect = 8e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLYVAERSLRTCRS HY+VKILKV +L Sbjct: 577 TWMYISVPLLLYVAERSLRTCRSGHYAVKILKVSVL 612 >XP_009799189.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana sylvestris] XP_016485369.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Nicotiana tabacum] Length = 926 Score = 64.3 bits (155), Expect = 8e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI +PLLLYVAERSLRTCRSEHY+ KILKV +L Sbjct: 603 TWMYISMPLLLYVAERSLRTCRSEHYTAKILKVSVL 638 >XP_015867690.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Ziziphus jujuba] XP_015870235.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Ziziphus jujuba] XP_015870436.1 PREDICTED: respiratory burst oxidase homolog protein E-like isoform X2 [Ziziphus jujuba] Length = 932 Score = 64.3 bits (155), Expect = 8e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPLLLY+AERS+RTCRSEHY+VKI+KV +L Sbjct: 586 TWMYISVPLLLYMAERSIRTCRSEHYAVKIIKVSVL 621