BLASTX nr result
ID: Lithospermum23_contig00050803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00050803 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI06087.1 Tubby, C-terminal, partial [Cynara cardunculus var. s... 73 2e-13 XP_007217746.1 hypothetical protein PRUPE_ppa009063mg [Prunus pe... 72 3e-13 XP_002272047.2 PREDICTED: tubby-like protein 8 [Vitis vinifera] ... 72 5e-13 ONI16526.1 hypothetical protein PRUPE_3G104500 [Prunus persica] 72 5e-13 ONI16527.1 hypothetical protein PRUPE_3G104500 [Prunus persica] 72 5e-13 XP_008228851.1 PREDICTED: tubby-like protein 8 [Prunus mume] 72 5e-13 XP_009354225.1 PREDICTED: tubby-like protein 8 [Pyrus x bretschn... 72 5e-13 XP_008342833.1 PREDICTED: tubby-like protein 8 [Malus domestica] 72 5e-13 ONI16528.1 hypothetical protein PRUPE_3G104500 [Prunus persica] 72 5e-13 XP_006493455.1 PREDICTED: tubby-like protein 8 isoform X2 [Citru... 72 5e-13 XP_006493454.1 PREDICTED: tubby-like protein 8 isoform X1 [Citru... 72 5e-13 ONK70496.1 uncharacterized protein A4U43_C05F34310 [Asparagus of... 70 1e-12 XP_016562991.1 PREDICTED: tubby-like protein 8 [Capsicum annuum] 71 1e-12 XP_015895814.1 PREDICTED: tubby-like protein 8 [Ziziphus jujuba] 71 1e-12 XP_008461206.1 PREDICTED: tubby-like protein 8 isoform X2 [Cucum... 70 2e-12 XP_008461205.1 PREDICTED: tubby-like protein 8 isoform X1 [Cucum... 70 2e-12 XP_004135888.1 PREDICTED: tubby-like protein 8 isoform X2 [Cucum... 70 2e-12 XP_011659490.1 PREDICTED: tubby-like protein 8 isoform X1 [Cucum... 70 2e-12 XP_011073226.1 PREDICTED: tubby-like protein 8 [Sesamum indicum] 70 2e-12 XP_004305468.2 PREDICTED: tubby-like protein 8 [Fragaria vesca s... 70 2e-12 >KVI06087.1 Tubby, C-terminal, partial [Cynara cardunculus var. scolymus] Length = 363 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAFSICLASIDSKLCCT+ Sbjct: 330 GKSKYVMDYRYPLTGYQAFSICLASIDSKLCCTM 363 >XP_007217746.1 hypothetical protein PRUPE_ppa009063mg [Prunus persica] Length = 308 Score = 72.0 bits (175), Expect = 3e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 275 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 308 >XP_002272047.2 PREDICTED: tubby-like protein 8 [Vitis vinifera] CBI25260.3 unnamed protein product, partial [Vitis vinifera] Length = 377 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 344 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 377 >ONI16526.1 hypothetical protein PRUPE_3G104500 [Prunus persica] Length = 391 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 358 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 391 >ONI16527.1 hypothetical protein PRUPE_3G104500 [Prunus persica] Length = 422 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 389 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 422 >XP_008228851.1 PREDICTED: tubby-like protein 8 [Prunus mume] Length = 422 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 389 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 422 >XP_009354225.1 PREDICTED: tubby-like protein 8 [Pyrus x bretschneideri] Length = 423 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 390 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 423 >XP_008342833.1 PREDICTED: tubby-like protein 8 [Malus domestica] Length = 423 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 390 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 423 >ONI16528.1 hypothetical protein PRUPE_3G104500 [Prunus persica] Length = 428 Score = 72.0 bits (175), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 395 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 428 >XP_006493455.1 PREDICTED: tubby-like protein 8 isoform X2 [Citrus sinensis] Length = 441 Score = 72.0 bits (175), Expect = 5e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMD+RYP TGYQAFSICLASIDSKLCCT+ Sbjct: 408 GKSKYVMDFRYPLTGYQAFSICLASIDSKLCCTI 441 >XP_006493454.1 PREDICTED: tubby-like protein 8 isoform X1 [Citrus sinensis] Length = 442 Score = 72.0 bits (175), Expect = 5e-13 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMD+RYP TGYQAFSICLASIDSKLCCT+ Sbjct: 409 GKSKYVMDFRYPLTGYQAFSICLASIDSKLCCTI 442 >ONK70496.1 uncharacterized protein A4U43_C05F34310 [Asparagus officinalis] Length = 281 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 248 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 281 >XP_016562991.1 PREDICTED: tubby-like protein 8 [Capsicum annuum] Length = 404 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GK+KYVMDYRYP TGYQAF ICLASIDSKLCCTV Sbjct: 371 GKAKYVMDYRYPLTGYQAFCICLASIDSKLCCTV 404 >XP_015895814.1 PREDICTED: tubby-like protein 8 [Ziziphus jujuba] Length = 420 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCCT+ Sbjct: 387 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCTL 420 >XP_008461206.1 PREDICTED: tubby-like protein 8 isoform X2 [Cucumis melo] Length = 401 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 368 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 401 >XP_008461205.1 PREDICTED: tubby-like protein 8 isoform X1 [Cucumis melo] Length = 402 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 369 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 402 >XP_004135888.1 PREDICTED: tubby-like protein 8 isoform X2 [Cucumis sativus] Length = 408 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 375 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 408 >XP_011659490.1 PREDICTED: tubby-like protein 8 isoform X1 [Cucumis sativus] KGN45201.1 hypothetical protein Csa_7G431340 [Cucumis sativus] Length = 409 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 376 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 409 >XP_011073226.1 PREDICTED: tubby-like protein 8 [Sesamum indicum] Length = 413 Score = 70.5 bits (171), Expect = 2e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF +CLAS+DSKLCCTV Sbjct: 380 GKSKYVMDYRYPLTGYQAFCMCLASVDSKLCCTV 413 >XP_004305468.2 PREDICTED: tubby-like protein 8 [Fragaria vesca subsp. vesca] Length = 414 Score = 70.5 bits (171), Expect = 2e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 239 GKSKYVMDYRYPFTGYQAFSICLASIDSKLCCTV 138 GKSKYVMDYRYP TGYQAF ICLASIDSKLCC+V Sbjct: 381 GKSKYVMDYRYPLTGYQAFCICLASIDSKLCCSV 414