BLASTX nr result
ID: Lithospermum23_contig00050514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00050514 (244 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERN04997.1 hypothetical protein AMTR_s05400p00003230 [Amborella ... 57 5e-08 ALP00626.1 hypothetical protein (mitochondrion) [Populus tremula... 51 7e-06 >ERN04997.1 hypothetical protein AMTR_s05400p00003230 [Amborella trichopoda] Length = 223 Score = 57.4 bits (137), Expect = 5e-08 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 116 KYLIYDTGCLEFAKRFIVDAGETDLSPVSIRCVQNYFHPNGLM 244 K +I DTGCLEFAKRF + G D+SP+SIR + +Y HP GLM Sbjct: 52 KSVISDTGCLEFAKRFRIRRGTVDISPISIRALLSYSHPYGLM 94 >ALP00626.1 hypothetical protein (mitochondrion) [Populus tremula] ALP46558.1 hypothetical protein (mitochondrion) [Populus tremula x Populus alba] Length = 166 Score = 50.8 bits (120), Expect = 7e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +3 Query: 3 WLMQFVHARGEQYSQGCLWAERTRFAFDRNN 95 +L++F+H+RGEQ+S G LW ERTRFA DR N Sbjct: 53 FLLEFIHSRGEQWSSGILWPERTRFALDRQN 83