BLASTX nr result
ID: Lithospermum23_contig00050512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00050512 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019192394.1 PREDICTED: DELLA protein DWARF8-like [Ipomoea nil] 56 1e-06 >XP_019192394.1 PREDICTED: DELLA protein DWARF8-like [Ipomoea nil] Length = 519 Score = 55.8 bits (133), Expect = 1e-06 Identities = 38/92 (41%), Positives = 49/92 (53%), Gaps = 8/92 (8%) Frame = -3 Query: 257 LSTWVDSFLSE-------DYVISDPGRFMGSLGWVGNNVVQHQQQLHEQI-GPLPLLAVQ 102 L +WVDS LSE ++ F+ + G G + + Q QI P L V Sbjct: 82 LGSWVDSLLSELHPPPVPEFAAPSDSNFVPAAGPTGWSECEAMLQQPPQIVSPAHLTVV- 140 Query: 101 NNTLMDHEESSIQLVHVLMTCADAVQRGEFSL 6 T M+ E+S I+LVH LMTCA +VQRGEFSL Sbjct: 141 --TAMEQEDSGIRLVHALMTCAVSVQRGEFSL 170