BLASTX nr result
ID: Lithospermum23_contig00050279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00050279 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Q43078.1 RecName: Full=Cytochrome P450 97B1, chloroplastic; AltN... 52 9e-06 >Q43078.1 RecName: Full=Cytochrome P450 97B1, chloroplastic; AltName: Full=Cytochrome P450 97A2; Flags: Precursor CAA89260.1 cytochrome P450 [Pisum sativum] Length = 552 Score = 51.6 bits (122), Expect = 9e-06 Identities = 34/81 (41%), Positives = 39/81 (48%) Frame = -2 Query: 245 AVLTWAVFLLAQVRCQTNFFFSTEIMFVLSYIGMLFISVRGCCI**TFIVQHPNKMKKAQ 66 AVLTWAVFLLAQ +P+KMKKAQ Sbjct: 369 AVLTWAVFLLAQ---------------------------------------NPDKMKKAQ 389 Query: 65 SEIDLVLGLGKLTLEALKKLE 3 +E+DLVLG+GK T E LKKLE Sbjct: 390 AEVDLVLGMGKPTFELLKKLE 410